FcZero-rAb® Biotin Anti-Mouse CD5 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• FcZero-rAb® Biotin Anti-Mouse CD5 Rabbit Recombinant Antibody (Biotin-FcA98038-2)

CD5 FcZero-rAb^® Recombinant Antibody for FC

Cat No. Biotin-FcA98038-2 Copied!

Clone No. 240244A7

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

240244A7_FcA98038, CD5 antigen, Ly 1, Ly 12, Ly A

• 

  FC experiment of mouse splenocytes using Biotin-FcA98038-2

  1x10^6 mouse splenocytes were surface stained with 0.25 ug Biotin Anti-Mouse CD5 Rabbit RecAb (Biotin-FcA98038-2, Clone: 240244A7) or FcZero-rAb® Biotin Rabbit IgG Isotype Control Recombinant Antibody (Biotin-FcA98136, Clone: 240953C9), and Streptavidin-PE Conjugate (PE-PF00030). Cells were then stained with FcZero-rAb® CoraLite® Plus 405 Anti-Mouse CD3e (145-2C11) Rabbit Recombinant Antibody (CL405-FcA65651, Clone: 145-2C11). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of mouse splenocytes using Biotin-FcA98038-2

  1x10^6 mouse splenocytes were surface stained with 0.25 ug Biotin Anti-Mouse CD5 Rabbit RecAb (Biotin-FcA98038-2, Clone: 240244A7) (red) or FcZero-rAb® Biotin Rabbit IgG Isotype Control Recombinant Antibody (Biotin-FcA98136, Clone: 240953C9) (blue), and Streptavidin-PE Conjugate (PE-PF00030). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CD5 in ?

Chat with Able

---

Tested Applications

• Positive FC detected in: mouse splenocytes

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-FcA98038-2 targets CD5 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0899

  Product name: Recombinant mouse CD5 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 24-370 aa of NM_007650.3

  Sequence: QSGRGGLDIQVMLSGSNSKCQGQVEIQMENKWKTVCSSSWRLSQDHSKNAQQASAVCKQLRCGDPLALGPFPSLNRPQNQVFCQGSPWSISNCNNTSSQDQCLPLSLICLEPQRTTPPPTTTPPTTVPEPTAPPRLQLVPGHEGLRCTGVVEFYNGSWGGTILYKAKDRPLGLGNLICKSLQCGSFLTHLSGTEAAGTPAPAELRDPRPLPIRWEAPNGSCVSLQQCFQKTTAQEGGQALTVICSDFQPKVQSRLVGGSSVCEGIAEVRQRSQWEALCDSSAARGRGRWEELCREQQCGDLISFHTVDADKTSPGFLCAQEKLSQCYHLQKKKHCNKRVFVTCQDPN

• Full Name: CD5 antigen
• Calculated Molecular Weight: 54 kDa
• GenBank Accession Number: NM_007650.3
• Gene Symbol: Cd5
• Gene ID (NCBI): 12507
• RRID: AB_3746879
• Conjugate: Biotin
• Excitation/Emission Maxima Wavelengths: -
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P13379
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD38, also known as ADP-ribosyl cyclase 1, is a type II transmembrane glycoprotein with a short N-terminal cytoplasmic tail, a single membrane-spanning domain, and a C-terminal extracellular region with four N-glycosylation sites (PMID: 2319135). The extracellular domain of CD38 has bifunctional enzyme activities that catalyze synthesis of cyclic ADP ribose from nicotinamide adenine dinucleotide (NAD) and hydrolysis of cyclic ADP ribose to adenosine diphosphoribose (PMID: 10636863). CD38 is expressed on a variety of hematopoietic and non-hematopoietic cells and is involved in diverse processes such as generation of calcium-mobilizing metabolites, cell activation, and chemotaxis (PMID: 25938500).