FcZero-rAb® CoraLite® Plus 594 Anti-Mouse CD5 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• FcZero-rAb® CoraLite® Plus 594 Anti-Mouse CD5 Rabbit Recombinant Antibody (CL594-FcA98038-2)

• Zero Fc receptor binding
• Site-specific conjugation
• One universal isotype

CD5 FcZero-rAb^® Recombinant Antibody for FC

Cat No. CL594-FcA98038-2 Copied!

Clone No. 240244A7

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

240244A7_FcA98038, CD5 antigen, Ly 1, Ly 12, Ly A

• 

  FC experiment of mouse splenocytes using CL594-FcA98038-2

  1x10^6 mouse splenocytes were surface stained with CoraLite® Plus 488 Anti-Mouse CD3e (145-2C11), and 0.25 ug CoraLite® Plus 594 Anti-Mouse CD5 Rabbit RecAb (CL594-FcA98038-2, Clone: 240244A7) or 0.25 ug FcZero-rAb® CoraLite® Plus 594 Rabbit IgG Isotype Control Recombinant Antibody (CL594-FcA98136, Clone: 240953C9). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of mouse splenocytes using CL594-FcA98038-2

  1x10^6 mouse splenocytes were surface stained with 0.25 ug CoraLite® Plus 594 Anti-Mouse CD5 Rabbit RecAb (CL594-FcA98038-2, Clone: 240244A7) (red) or 0.25 ug FcZero-rAb® CoraLite® Plus 594 Rabbit IgG Isotype Control Recombinant Antibody (CL594-FcA98136, Clone: 240953C9) (blue). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CD5 in ?

Chat with Able

---

Tested Applications

• Positive FC detected in: mouse splenocytes

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-FcA98038-2 targets CD5 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0899

  Product name: Recombinant mouse CD5 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 24-370 aa of NM_007650.3

  Sequence: QSGRGGLDIQVMLSGSNSKCQGQVEIQMENKWKTVCSSSWRLSQDHSKNAQQASAVCKQLRCGDPLALGPFPSLNRPQNQVFCQGSPWSISNCNNTSSQDQCLPLSLICLEPQRTTPPPTTTPPTTVPEPTAPPRLQLVPGHEGLRCTGVVEFYNGSWGGTILYKAKDRPLGLGNLICKSLQCGSFLTHLSGTEAAGTPAPAELRDPRPLPIRWEAPNGSCVSLQQCFQKTTAQEGGQALTVICSDFQPKVQSRLVGGSSVCEGIAEVRQRSQWEALCDSSAARGRGRWEELCREQQCGDLISFHTVDADKTSPGFLCAQEKLSQCYHLQKKKHCNKRVFVTCQDPN

• Full Name: CD5 antigen
• Calculated Molecular Weight: 54 kDa
• GenBank Accession Number: NM_007650.3
• Gene Symbol: Cd5
• Gene ID (NCBI): 12507
• Conjugate: CoraLite® Plus 594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Excitation Laser: Yellow-Green Laser (561 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P13379
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD5 is a type I transmembrane glycoprotein of the scavenger receptor cysteine-rich family (PMID: 12403363). CD5 is expressed on a majority of thymocytes, mature T cells, B cell subsets, and peripheral blood dendritic cells (PMID: 9858516; 6156984; 10379049; 1384337). CD5 may act as a receptor in regulating T-cell proliferation. It functions as a negative regulator of TCR signaling during thymocyte development (PMID: 7542801).