FITC Plus-conjugated CD62L Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FITC Plus-conjugated CD62L Polyclonal antibody (FITC-33173)

CD62L Polyclonal Antibody for IF-P

Cat No. FITC-33173 Copied!

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

IF-P

Synonyms

L-selectin, CD62 antigen-like family member L, L selectin, LAM-1, LECAM 1

• 

  IF Staining of mouse spleen using FITC-33173

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse spleen tissue using FITC Plus CD62L antibody (FITC-33173) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CD62L in ?

Chat with Able

---

Tested Applications

• Positive IF-P detected in: mouse spleen tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

FITC-33173 targets CD62L in IF-P applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg3845

  Product name: Recombinant Mouse CD62L protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 39-332 aa of NM_011346.2

  Sequence: WTYHYSEKPMNWENARKFCKQNYTDLVAIQNKREIEYLENTLPKSPYYYWIGIRKIGKMWTWVGTNKTLTKEAENWGAGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPGSCNGRGECVETINNHTCICDAGYYGPQCQYVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQETNRSFSKIKEGDYN

• Full Name: selectin, lymphocyte
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 80-90 kDa
• GenBank Accession Number: NM_011346.2
• Gene Symbol: CD62L
• Gene ID (NCBI): 20343
• Conjugate: FITC Plus Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 495 nm / 524 nm
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P18337
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

CD62L, also known as L-selectin or SELL, is a member of the selectin family of adhesion molecules that also include CD62E (E-selectin) and CD62P (P-selectin) (PMID: 2663882, 2473156, 1382078). CD62L is a highly glycosylated protein expressed on the surface of most leukocytes, including lymphocytes, neutrophils, monocytes, eosinophils, hematopoietic progenitor cells, and immature thymocytes (PMID: 1694883, 1688580). It mediates the binding of lymphocytes to high endothelial venules (HEV) of peripheral lymph nodes through interactions with a constitutively expressed ligand, and is also involved in lymphocyte, neutrophil, and monocyte attachment to endothelium at sites of inflammation (PMID: 1382078).