• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated CD63 Polyclonal antibody

CD63 Polyclonal Antibody for
Cat No. CL488-25682

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Ocular melanoma-associated antigen, Lysosome integral membrane protein 1, Lysosomal-associated membrane protein 3, Limp1, CD63 antigen

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHL-60 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-25682 targets CD63 in applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag19690

Product name: Recombinant human CD63 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 104-209 aa of BC002349

Sequence: GYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAA

Predict reactive species
Full Name CD63 molecule
Calculated Molecular Weight 26 kDa
GenBank Accession NumberBC002349
Gene Symbol CD63
Gene ID (NCBI) 967
RRIDAB_2919203
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP08962
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CD63 is a 30-60 kDa lysosomal membrane protein that belongs to the tetraspanin family. This protein plays many important roles in immuno-physiological functions. It mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. CD63 is expressed on activated platelets, thus it may function as a blood platelet activation marker. CD63 is a lysosomal membrane glycoprotein that is translocated to plasma membrane after platelet activation. The CD63 tetraspanin is highly expressed in the early stages of melanoma and decreases in advanced lesions, suggesting it as a possible suppressor of tumor progression. Deficiency of this protein is associated with Hermansky-Pudlak syndrome.

Loading...
||
New chat

Able

正在加载,请稍候...