Use Able AI chat for product recommendations

CoraLite® Plus 488-conjugated CD68 Polyclonal antibody

CD68 Polyclonal Antibody for IF-P

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF-P

CD68 molecule, GP110, Macrosialin, SCARD1

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for CD68 in ?

Tested Applications

Positive IF-P detected inhuman tonsillitis tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-25747 targets CD68 in IF-P applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag22815

Product name: Recombinant human CD68 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 29-319 aa of BC015557

Sequence: SATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSCPSDRS

Predict reactive species
Full Name CD68 molecule
Calculated Molecular Weight 37 kDa
Observed Molecular Weight 60 kDa
GenBank Accession NumberBC015557
Gene Symbol CD68
Gene ID (NCBI) 968
RRIDAB_2919205
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP34810
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CD68 is a type I transmembrane glycoprotein that is highly expressed by human monocytes and tissue macrophages. It belongs to the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family and primarily localizes to lysosomes and endosomes with a smaller fraction circulating to the cell surface. CD68 is also a member of the scavenger receptor family. It may play a role in phagocytic activities of tissue macrophages. The apparent molecular weight of CD68 is larger than calculated molecular weight due to post-translation modification.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 CD68 antibody CL488-25747Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

CD68 Polyclonal antibody (CoraLite® Plus 488), catalog number CL488-25747, has 4 citations. These appear in Nature Communications, Journal of Neuroinflammation, PeerJ, and bioRxiv. The research fields span alcohol-induced hepatocyte ferroptosis, T cell-mediated neuroinflammation in SIV infection, immunosuppressive macrophages in hepatocellular carcinoma, and macrophage PD-1 regulation in immunotherapy.

SpeciesApplicationTitle
IF

Nat Commun

ACSS2 protects against alcohol-induced hepatocyte ferroptosis through regulation of hepcidin expression

Authors - Mengyao Wang

J Neuroinflammation

T cell-mediated SIV dissemination into the CNS: a single-cell transcriptomic analysis

Authors - Xiaoke Xu
IF

PeerJ

Integrated multiomics analysis highlights the immunosuppressive role of granulin precursor positive macrophages in hepatocellular carcinoma

Authors - Jun Li
humanIF

bioRxiv

An Endocytic Checkpoint Controls Macrophage PD-1 Function and Immunotherapy Fate.

Authors - Madhubanti Mullick

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

One reviewer, Jyoti Chhimwal, gave a 5-star rating for using this antibody in immunofluorescence on human liver tissue. They reported excellent performance at a 1:100 dilution with 5% goat serum as the diluent, noting that the antibody "worked really nice." The review was posted on July 17, 2026, and used lot 21020071.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Jyoti (Verified Customer) (07-17-2026)

I used this antibody for immunofluorescence in human liver tissue. It worked really nice at a dilution of 1:100. I used 5% goat serum for the dilution.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Human liver tissue
Loading...
||
New chat

Able™

正在加载,请稍候...