CoraLite® Plus 647 Anti-Human CD68 Rabbit Recombinant Antibody

CD68 Uni-rAb® Recombinant Antibody for FC (Intra)
Cat No. CL647-98242
Clone No.241810G1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

241810G1, CD68 molecule, GP110, Macrosialin, SCARD1

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inhuman PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 5 ul per 10^6 cells in 100 μl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-98242 targets CD68 in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2061

Product name: Recombinant Human CD68 protein (rFc Tag)(HPLC verified)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 22-319 aa of BC015557

Sequence: NDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSCPSDRS

Predict reactive species
Full Name CD68 molecule
Calculated Molecular Weight 37 kDa
GenBank Accession NumberBC015557
Gene Symbol CD68
Gene ID (NCBI) 968
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP34810
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD68 is a type I transmembrane glycoprotein that is highly expressed by human monocytes and tissue macrophages. It belongs to the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family and primarily localizes to lysosomes and endosomes with a smaller fraction circulating to the cell surface. CD68 is also a member of the scavenger receptor family. It may play a role in phagocytic activities of tissue macrophages.

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 CD68 antibody CL647-98242Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...