CoraLite®594 Anti-Mouse CD70 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• CoraLite®594 Anti-Mouse CD70 Rabbit Recombinant Antibody (CL594-98212)

CD70 Uni-rAb^® Recombinant Antibody for FC

Cat No. CL594-98212 Copied!

Clone No. 241553F2

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

241553F2, CD27 ligand, Cd27l, CD27-L, Cd27lg

• 

  FC experiment of mouse splenocytes using CL594-98212

  1x10^6 untreated (left) or LPS treated (right) mouse splenocytes were surface stained with 0.25 ug CoraLite®594 Anti-Mouse CD70 Rabbit RecAb (CL594-98212, Clone: 241553F2). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of mouse splenocytes using CL594-98212

  1x10^6 LPS treated mouse splenocytes were surface stained with 0.5 ug CoraLite®594 Anti-Mouse CD70 Rabbit RecAb (CL594-98212, Clone: 241553F2) (red) or CoraLite®594 Rabbit IgG Isotype Control Recombinant Antibody (CL594-98136, Clone: 240953C9) (blue). Untreated mouse splenocytes were surface stained with 0.5 ug CoraLite®594 Anti-Mouse CD70 Rabbit RecAb (CL594-98212, Clone: 241553F2) (black, dashed). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CD70 in ?

Chat with Able

---

Tested Applications

• Positive FC detected in: LPS treated mouse splenocytes

Recommended dilution

• Flow Cytometry (FC): FC : 0.5 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-98212 targets CD70 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1294

  Product name: Recombinant Mouse CD70 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: N-6*His

  Domain: 45-195 aa of NM_011617.2

  Sequence: SKQQQRLLEHPEPHTAELQLNLTVPRKDPTLRWGAGPALGRSFTHGPELEEGHLRIHQDGLYRLHIQVTLANCSSPGSTLQHRATLAVGICSPAAHGISLLRGRFGQDCTVALQRLTYLVHGDVLCTNLTLPLLPSRNADETFFGVQWICP

• Full Name: CD70 antigen
• Calculated Molecular Weight: 22 kDa
• GenBank Accession Number: NM_011617.2
• Gene Symbol: Cd70
• Gene ID (NCBI): 21948
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Excitation Laser: Yellow-Green Laser (561 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O55237
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD70, also known as tumor necrosis factor ligand superfamily member 7 (TNFSF7) or CD27 ligand (CD27L), is a transmembrane protein that plays a significant role in the immune system. It is the unique ligand for CD27, a member of the tumor necrosis factor receptor (TNFR) family, and is transiently upregulated upon stimulation of immune cells. CD70 is expressed on lymphocytes and dendritic cells, and its expression can be regulated by activation signals received via toll-like receptors (TLRs), CD40, and the antigen receptor MHC II. It provides complex and not completely understood signaling for B cell development. CD70 is also expressed on various solid tumors and hematolymphoid malignancies, where it may contribute to a poor prognosis. (PMID: 34991665; 26213107; 26098609)