CD72 Monoclonal antibody

• 

  WB analysis of Daudi using 67424-1-Ig

  Daudi cells were subjected to SDS PAGE followed by western blot with 67424-1-Ig (CD72 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human tonsillitis using 67424-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67424-1-Ig (CD72 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 67424-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67424-1-Ig (CD72 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 67424-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67424-1-Ig (CD72 antibody) at dilution of 1:1000 (under 4x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human tonsillitis using 67424-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CD72 antibody (67424-1-Ig, Clone: 2C1C6 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of Ramos using 67424-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed Ramos cells using CD72 antibody (67424-1-Ig, Clone: 2C1C6 ) at dilution of 1:1600 and CoraLite®594-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

CD72 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 67424-1-Ig

Clone No.2C1C6

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IHC, IF/ICC, IF-P, ELISA

Synonyms

2C1C6, B-cell differentiation antigen CD72, CD72 molecule, CD72b, Lyb 2

---

Tested Applications

• Positive WB detected in: Daudi cells
• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human tonsillitis tissue, Ramos cells
• Positive IF/ICC detected in: Ramos cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:800-1:3200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67424-1-Ig targets CD72 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14405

  Product name: Recombinant human CD72 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 116-359 aa of BC030227

  Sequence: VRYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPD

• Full Name: CD72 molecule
• Calculated Molecular Weight: 359 aa, 40 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC030227
• Gene Symbol: CD72
• Gene ID (NCBI): 971
• RRID: AB_2882663
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P21854
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD72 is a type II transmembrane glycoprotein of 39-45 kDa and is expressed as a disulphide-linked homodimer (PMID: 1711157). CD72 is a pan B-cell marker covering the full range of differentiation from the very early stages of B cells to mature surface Ig+ B cells (PMID: 1384316). It is expressed in all stages of B cell development except plasma cells. CD72 is also expressed by dendritic cells, tissue macrophages in the red pulp of the spleen and von Kupffer cells in the liver (PMID: 8561576; 1384316). CD72 is the ligand for CD5 (PMID: 1711157). CD72 is a negative regulator of BCR signaling (PMID: 9590210). Interaction of CD100 with CD72 strictly tunes the strength of BCR signals and is essential for maintaining immunological homeostasis as well as generating a proper immune response (PMID: 16113236).