CoraLite®594-conjugated CD72 Monoclonal antibody

CD72 Monoclonal Antibody for IF-P
Cat No. CL594-67424
Clone No.2C1C6

Host / Isotype

Mouse / IgG2b

Reactivity

Human

Applications

IF-P

CD72, CD72 molecule, CD72b, Lyb 2, LYB2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman tonsillitis tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67424 targets CD72 in IF-P applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag14405

Product name: Recombinant human CD72 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 116-359 aa of BC030227

Sequence: VRYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPD

Predict reactive species
Full Name CD72 molecule
Calculated Molecular Weight 359 aa, 40 kDa
GenBank Accession NumberBC030227
Gene Symbol CD72
Gene ID (NCBI) 971
RRIDAB_2920132
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP21854
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CD72 is a type II transmembrane glycoprotein of 39-45 kDa and is expressed as a disulphide-linked homodimer (PMID: 1711157). CD72 is a pan B-cell marker covering the full range of differentiation from the very early stages of B cells to mature surface Ig+ B cells (PMID: 1384316). It is expressed in all stages of B cell development except plasma cells. CD72 is also expressed by dendritic cells, tissue macrophages in the red pulp of the spleen and von Kupffer cells in the liver (PMID: 8561576; 1384316). CD72 is the ligand for CD5 (PMID: 1711157). CD72 is a negative regulator of BCR signaling (PMID: 9590210). Interaction of CD100 with CD72 strictly tunes the strength of BCR signals and is essential for maintaining immunological homeostasis as well as generating a proper immune response (PMID: 16113236).

Protocols

Product Specific Protocols
IF protocol for CL594 CD72 antibody CL594-67424Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...