CoraLite®594-conjugated CD72 Monoclonal antibody

• 

  IF Staining of human tonsillitis using CL594-67424

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CoraLite®594-conjugated CD72 antibody (CL594-67424, Clone: 2C1C6 ) at dilution of 1:100.

• 

  IF Staining of human tonsillitis using CL594-67424

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CoraLite®594-conjugated CD72 antibody (CL594-67424, Clone: 2C1C6 ) at dilution of 1:100.

CD72 Monoclonal Antibody for IF-P

Cat No. CL594-67424

Clone No.2C1C6

Host / Isotype

Mouse / IgG2b

Reactivity

Human

Applications

IF-P

Synonyms

CD72, CD72 molecule, CD72b, Lyb 2, LYB2

---

Tested Applications

• Positive IF-P detected in: human tonsillitis tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67424 targets CD72 in IF-P applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14405

  Product name: Recombinant human CD72 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 116-359 aa of BC030227

  Sequence: VRYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPD

• Full Name: CD72 molecule
• Calculated Molecular Weight: 359 aa, 40 kDa
• GenBank Accession Number: BC030227
• Gene Symbol: CD72
• Gene ID (NCBI): 971
• RRID: AB_2920132
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P21854
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

CD72 is a type II transmembrane glycoprotein of 39-45 kDa and is expressed as a disulphide-linked homodimer (PMID: 1711157). CD72 is a pan B-cell marker covering the full range of differentiation from the very early stages of B cells to mature surface Ig+ B cells (PMID: 1384316). It is expressed in all stages of B cell development except plasma cells. CD72 is also expressed by dendritic cells, tissue macrophages in the red pulp of the spleen and von Kupffer cells in the liver (PMID: 8561576; 1384316). CD72 is the ligand for CD5 (PMID: 1711157). CD72 is a negative regulator of BCR signaling (PMID: 9590210). Interaction of CD100 with CD72 strictly tunes the strength of BCR signals and is essential for maintaining immunological homeostasis as well as generating a proper immune response (PMID: 16113236).