Anti-Mouse CD79a Rabbit Recombinant Antibody

CD79a Uni-rAb® Recombinant Antibody for FC (Intra)
Cat No. 98129-1-RR
Clone No.241231F7

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

241231F7, B-cell antigen receptor complex-associated protein alpha chain, Mb-1

Formulation:  PBS, Azide
PBS, Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inmouse splenocytes

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

98129-1-RR targets CD79a in FC (Intra) applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1388

Product name: Recombinant Mouse CD79A protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 29-137 aa of NM_007655.3

Sequence: LRVEGGPPSLTVNLGEEARLTCENNGRNPNITWWFSLQSNITWPPVPLGPGQGTTGQLFFPEVNKNHRGLYWCQVIENNILKRSCGTYLRVRNPVPRPFLDMGEGTKNR

Predict reactive species
Full Name CD79A antigen (immunoglobulin-associated alpha)
Calculated Molecular Weight25 kDa
GenBank Accession NumberNM_007655.3
Gene Symbol Cd79a
Gene ID (NCBI) 12518
RRIDAB_3672275
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP11911
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2 - 8°C. Stable for one year after shipment.

Background Information

CD79a, also named as B-cell antigen receptor complex-associated protein alpha chain or MB-1 membrane glycoprotein, is a 226 amino acid protein, which contains one ITAM domain and one Ig-like C2-type (immunoglobulin-like) domain. CD79A is expressed in B cell and localizes in the cell membrane. CD79A is required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. CD79A is also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells.

Protocols

Product Specific Protocols
FC protocol for CD79a antibody 98129-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...