FcZero-rAb® APC Anti-Mouse CD79a Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• FcZero-rAb® APC Anti-Mouse CD79a Rabbit Recombinant Antibody (APC-FcA98129)

• Zero Fc receptor binding
• Site-specific conjugation
• One universal isotype

CD79a FcZero-rAb^® Recombinant Antibody for FC (Intra)

Cat No. APC-FcA98129 Copied!

Clone No. 241231F7

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

Synonyms

B-cell antigen receptor complex-associated protein alpha chain, Mb-1

• 

  FC experiment of mouse splenocytes using APC-FcA98129

  1x10^6 mouse splenocytes were intracellularly stained with 0.1 ug APC Anti-Mouse CD79a Rabbit RecAb (APC-FcA98129, Clone: 241231F7) or APC Rabbit IgG Isotype Control RecAb (APC-FcA98136, Clone: 240953C9). Cells were co-stained with CoraLite® Plus 488 Anti-Mouse CD45R (B220) (RA3-6B2). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of mouse splenocytes using APC-FcA98129

  1x10^6 mouse splenocytes were intracellularly stained with 0.1 ug APC Anti-Mouse CD79a Rabbit RecAb (APC-FcA98129, Clone: 241231F7) (red) or APC Rabbit IgG Isotype Control RecAb (APC-FcA98136, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CD79a in ?

Chat with Able

---

Tested Applications

• Positive FC (Intra) detected in: mouse splenocytes

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.1 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

APC-FcA98129 targets CD79a in FC (Intra) applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1388

  Product name: Recombinant Mouse CD79A protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 29-137 aa of NM_007655.3

  Sequence: LRVEGGPPSLTVNLGEEARLTCENNGRNPNITWWFSLQSNITWPPVPLGPGQGTTGQLFFPEVNKNHRGLYWCQVIENNILKRSCGTYLRVRNPVPRPFLDMGEGTKNR

• Full Name: CD79A antigen (immunoglobulin-associated alpha)
• Calculated Molecular Weight: 25 kDa
• GenBank Accession Number: NM_007655.3
• Gene Symbol: Cd79a
• Gene ID (NCBI): 12518
• RRID: AB_3746544
• Conjugate: APC Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm
• Excitation Laser: Red Laser (633 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P11911
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD79a, also named as B-cell antigen receptor complex-associated protein alpha chain or MB-1 membrane glycoprotein, is a 226 amino acid protein, which contains one ITAM domain and one Ig-like C2-type (immunoglobulin-like) domain. CD79A is expressed in B cell and localizes in the cell membrane. CD79A is required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. CD79A is also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells.