CoraLite® Plus 488-conjugated CD82 Monoclonal antibody

CD82 Monoclonal Antibody for IF-P
Cat No. CL488-66803
Clone No.1E7A4

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse

Applications

IF-P

CD82, KAI1, Metastasis suppressor Kangai-1, IA4, CD82,KAI1, CD 82

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman tonsillitis tissue, human ovary tumor tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66803 targets CD82 in IF-P applications and shows reactivity with Human, mouse samples.

Tested Reactivity Human, mouse
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17513

Product name: Recombinant human CD82 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 35-264 aa of BC000726

Sequence: LADKSSFISVLQTSSSSLRMGAYVFIGVGAVTMLMGFLGCIGAVNEVRCLLGLYFAFLLLILIAQVTAGALFYFNMGKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAIVELLGMVLSICLCRHVHSEDYSKV

Predict reactive species
Full Name CD82 molecule
Calculated Molecular Weight 30 kDa
GenBank Accession NumberBC000726
Gene Symbol CD82
Gene ID (NCBI) 3732
RRIDAB_2919374
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP27701
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CD82 is a membrane glycoprotein and belongs to the tetraspanin superfamily, many of which are implicated in the regulation of cell motility, morphology, fusion, signaling, fertilization, and differentiation. CD82 was originally identified as a suppressor of metastasis located on human chromosome 11p11.2 in prostate carcinoma. The majority of evidence indicates that CD82 expression is downregulated or abolished in a variety of malignant tumors. CD82 is present at high levels in human monocyte and macrophage lineages and in various epithelial cells in the prostate, lung, pancreas and many other tissues. In epithelial cells, CD82 is implicated in diverse biological processes such as cell adhesion, migration, apoptosis and morphogenesis.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 CD82 antibody CL488-66803Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

EMBO Mol Med

Dual targeting of CDK6 and LSD1 is synergistic and overcomes differentiation blockade in AML

Authors - Lise Brault
Loading...
||
New chat

Able

正在加载,请稍候...