CD83 Recombinant monoclonal antibody, PBS Only (Detector)

CD83 Uni-rAb® Recombinant Antibody for WB, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 84796-3-PBS
Clone No.241855G5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Sandwich ELISA, Indirect ELISA, Sample test

241855G5, B cell activation protein, B-cell activation protein, BL11, CD83 antigen

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84796-3-PBS targets CD83 as part of a matched antibody pair:

MP01570-3: 84796-4-PBS capture and 84796-3-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2033

Product name: Recombinant Human CD83 protein (rFc Tag) (HPLC verified)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 20-143 aa of NM_004233.4

Sequence: TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA

Predict reactive species
Full Name CD83 molecule
Calculated Molecular Weight23 kDa
Observed Molecular Weight40-45 kDa
GenBank Accession NumberNM_004233.4
Gene Symbol CD83
Gene ID (NCBI) 9308
ENSEMBL Gene IDENSG00000112149
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ01151
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CD83 is a member of the immunoglobulin (Ig) superfamily, consisting of an extracellular V-type Ig-like domain, a transmembrane domain, and a cytoplasmic tail. CD83 is one of the most prominent markers for fully matured dendritic cells (DCs) (PMID: 17334966). It is also found on the surface of other activated hematopoietic cells, including lymphocytes, monocytes, macrophages, and neutrophils (PMID: 31231400; 17334966). CD83 regulates the maturation, activation, and homeostasis of numerous immune cells (PMID: 31231400; 32362900). CD83 can also expressed as a soluble form. Soluble CD83 can bind to DCs and inhibit their maturation (PMID: 17334966; 12403928).

Loading...
||
New chat Able
正在加载,请稍候...