Biotin Anti-Human CD9 Rabbit scFv Antibody

• Home
• Products
• Primary Antibodies
• Biotin Anti-Human CD9 Rabbit scFv Antibody (Biotin-SF98095)

• 

  FC experiment of human PBMCs using Biotin-SF98095

  1x10^6 human PBMCs were surface stained with 0.25 ug Biotin Anti-Human CD9 Rabbit scFv Antibody (Biotin-SF98095, Clone: 240830E6) or 0.25 ug Isotype Control, and PE Streptavidin (Cat.No. PF00021). Cells were co-stained with 0.25 ug FcZero-rAb™ CoraLite® Plus 750 Anti-Human CD3 (UCHT1) Rabbit IgG Recombinant Antibody (CL750-FcA65570, Clone: UCHT1). Cells were not fixed.

• 

  FC experiment of human PBMCs using Biotin-SF98095

  1x10^6 human PBMCs were surface stained with 0.25 ug Biotin Anti-Human CD9 Rabbit scFv Antibody (Biotin-SF98095, Clone:240830E6) or 0.25 ug Isotype Control, and PE Streptavidin (Cat.No. PF00021). Cells were not fixed.

• Site-specific conjugation

CD9 Recombinant Antibody for FC, ELISA

Cat No. Biotin-SF98095

Clone No.240830E6

Host / Type

Rabbit / scFv

Reactivity

human

Applications

FC, ELISA

Synonyms

5H9, 5H9 antigen, BA2, BTCC 1, CD9 antigen

---

Tested Applications

• Positive FC detected in: human PBMCs

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-SF98095 targets CD9 in FC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Type: Rabbit / scFv
• Class: Recombinant
• Type: Single-chain variable fragment antibody (scFv)
• Immunogen:

  CatNo: Eg1037

  Product name: recombinant human CD9 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 112-195 aa of NM_001769.4

  Sequence: SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI

• Full Name: CD9 molecule
• Calculated Molecular Weight: 25 kDa
• GenBank Accession Number: NM_001769.4
• Gene Symbol: CD9
• Gene ID (NCBI): 928
• RRID: AB_3747078
• Conjugate: Biotin
• Excitation/Emission Maxima Wavelengths: -
• Source: Anti-Human CD9 scFv from clone 240830E6, consisting of VL-GGGGS linker-VH (N- to C-terminus), with a His tag at the C-terminus.
• Form: Liquid
• Purification Method: Affinity purification
• Storage Buffer: PBS with 4% sucrose and 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. 20ul sizes contain 0.1% BSA.

Background Information

The cell-surface molecule CD9, a member of the transmembrane-4 superfamily, interacts with the integrin family and other membrane proteins, and is postulated to participate in cell migration and adhesion. Expression of CD9 enhances membrane fusion between muscle cells and promotes viral infection in some cells (PMID:10459022). It is often used as a mesenchymal stem cell marker (PMID:18005405).