Use Able AI chat for product recommendations
  • Site-specific conjugation

CoraLite® Plus 405 Anti-Human CD9 Rabbit scFv Antibody

CD9 Recombinant Antibody for FC

Cat No. CL405-SF98095
Clone No.240830E6

Host / Type

Rabbit / scFv

Reactivity

human

Applications

FC

5H9, 5H9 antigen, BA2, BTCC 1, CD9 antigen

Formulation:  HEPES, EDTA, CHAPS, Sucrose, Proclin300
HEPES, EDTA, CHAPS, Sucrose, Proclin300
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inhuman PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL405-SF98095 targets CD9 in FC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Type Rabbit / scFv
Class Recombinant
Type Single-chain variable fragment antibody (scFv)
Immunogen

CatNo: Eg1037

Product name: recombinant human CD9 protein

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 112-195 aa of NM_001769.4

Sequence: SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI

Predict reactive species
Full Name CD9 molecule
Calculated Molecular Weight25 kDa
GenBank Accession NumberNM_001769.4
Gene Symbol CD9
Gene ID (NCBI) 928
RRIDAB_3747210
Conjugate CoraLite® Plus 405 Fluorescent Dye
Excitation/Emission Maxima Wavelengths399 nm / 422 nm
Excitation LaserViolet Laser (405 nm)
SourceAnti-Human CD9 scFv from clone 240830E6, consisting of VL-GGGGS linker-VH (N- to C-terminus), with a His tag at the C-terminus.
FormLiquid
Purification MethodAffinity purification
Storage Buffer 50mM HEPES, 150mM NaCl, 5mM EDTA, 0.1% CHAPS, 10% Sucrose and 0.1% Proclin 300, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment. 20ul sizes contain 0.1% BSA.

Background Information

The cell-surface molecule CD9, a member of the transmembrane-4 superfamily, interacts with the integrin family and other membrane proteins, and is postulated to participate in cell migration and adhesion. Expression of CD9 enhances membrane fusion between muscle cells and promotes viral infection in some cells (PMID:10459022). It is often used as a mesenchymal stem cell marker (PMID:18005405).

Protocols

Product Specific Protocols
FC protocol for CL Plus 405 CD9 antibody CL405-SF98095Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...