Product Information
28579-1-PBS targets CDA in WB, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29507 Product name: Recombinant human CDA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 42-146 aa of NM_001785 Sequence: LLTQEGRIFKGCNIENACYPLGICAERTAIQKAVSEGYKDFRAIAIASDMQDDFISPCGACRQVMREFGTNWPVYMTKPDGTYIVMTVQELLPSSFGPEDLQKTQ Predict reactive species |
| Full Name | cytidine deaminase |
| Calculated Molecular Weight | 16 kDa |
| Observed Molecular Weight | 16 kDa |
| GenBank Accession Number | NM_001785 |
| Gene Symbol | CDA |
| Gene ID (NCBI) | 978 |
| RRID | AB_2881174 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P32320 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |



