Filter: AllWBFC (Intra)

WB analysis using 28579-1-AP (same clone as 28579-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 28579-1-AP (CDA antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28579-1-PBS in a different storage buffer formulation.
FC experiment of HeLa using 28579-1-AP (same clone as 28579-1-PBS)
1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human CDA (28579-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Rabbit IgG control Rabbit PolyAb (30000-0-AP, Clone: ) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 28579-1-PBS in a different storage buffer formulation.
×
1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human CDA (28579-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Rabbit IgG control Rabbit PolyAb (30000-0-AP, Clone: ) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 28579-1-PBS in a different storage buffer formulation.

CDA Polyclonal antibody, PBS Only

Name: CDA Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 28579-1-PBS

CDA Polyclonal Antibody for WB, FC (Intra), Indirect ELISA

Cat No. 28579-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

28579-1-PBS targets CDA in WB, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag29507 Product name: Recombinant human CDA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 42-146 aa of NM_001785 Sequence: LLTQEGRIFKGCNIENACYPLGICAERTAIQKAVSEGYKDFRAIAIASDMQDDFISPCGACRQVMREFGTNWPVYMTKPDGTYIVMTVQELLPSSFGPEDLQKTQ Predict reactive species
Full Name	cytidine deaminase
Calculated Molecular Weight	16 kDa
Observed Molecular Weight	16 kDa
GenBank Accession Number	NM_001785
Gene Symbol	CDA
Gene ID (NCBI)	978
RRID	AB_2881174
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P32320
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™