CDC14B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CDC14B Polyclonal antibody, PBS Only (25187-1-PBS)

• 

  WB analysis of SMMC-7721 using 25187-1-AP (same clone as 25187-1-PBS)

  SMMC-7721 cells were subjected to SDS PAGE followed by western blot with 25187-1-AP (CDC14B Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25187-1-PBS in a different storage buffer formulation.

CDC14B Polyclonal Antibody for WB, Indirect ELISA

Cat No. 25187-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

25187-1-PBS targets CDC14B in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18227

  Product name: Recombinant human CDC14B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 349-498 aa of BC156666

  Sequence: PGSVIGPQQQFLVMKQTNLWLEGDYFRQKLKGQENGQHRAAFSKLLSGVDDISINGVENQDQQEPEPYSDDDEINGVTQGDRLRALKSRRQSKTNAIPLTVILQSSVQSCKTSEPNISGSAGITKRTTRSASRKSSVKSLSISRTKTVLR

• Full Name: CDC14 cell division cycle 14 homolog B (S. cerevisiae)
• Calculated Molecular Weight: 498 aa, 57 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC156666
• Gene Symbol: CDC14B
• Gene ID (NCBI): 8555
• RRID: AB_2879949
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60729
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.