CDC25C Monoclonal antibody, PBS Only

• 

  WB analysis using 66912-1-Ig (same clone as 66912-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66912-1-Ig (CDC25C antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 66912-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66912-1-Ig (same clone as 66912-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66912-1-Ig (CDC25C antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66912-1-PBS in a different storage buffer formulation.

CDC25C Monoclonal Antibody for WB, Indirect ELISA

Cat No. 66912-1-PBS

Clone No.2B6B12

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

2B6B12, CDC25, EC:3.1.3.48, M phase inducer phosphatase 3, M-phase inducer phosphatase 3

---

Product Information

66912-1-PBS targets CDC25C in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10240

  Product name: Recombinant human CDC25C protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-279 aa of BC019089

  Sequence: MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKCCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQ

• Full Name: cell division cycle 25 homolog C (S. pombe)
• Calculated Molecular Weight: 473 aa, 53 kDa
• Observed Molecular Weight: 46-53 kDa
• GenBank Accession Number: BC019089
• Gene Symbol: CDC25C
• Gene ID (NCBI): 995
• RRID: AB_2882239
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P30307
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The cell division cycle 25 (CDC25) family of proteins are highly conserved dual specificity phosphatases that activate cyclin-dependent kinase (CDK) complexes, which in turn regulate progression through the cell division cycle. CDC25C (cell division cycle 25 homolog C) is one of the 3 isoforms of CDC25 in mammalian cells. It is present in the cytoplasm of asynchronously growing human cells (PMID:10330186). And it may be phosphorylated by its own substrate, an active cdc2-cyclin B complex, to create an autoactivation loop (PMID:7937793). It can be hyperphosphorylated to get the active form of 70 kDa (PMID:18296513). CDC25C has some isofroms with molecular mass of 46-53 kDa.