CDC25C Monoclonal antibody, PBS Only

CDC25C Monoclonal Antibody for WB, Indirect ELISA
Cat No. 66912-1-PBS
Clone No.2B6B12

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

2B6B12, CDC25, EC:3.1.3.48, M phase inducer phosphatase 3, M-phase inducer phosphatase 3

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66912-1-PBS targets CDC25C in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag10240

Product name: Recombinant human CDC25C protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-279 aa of BC019089

Sequence: MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKCCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQ

Predict reactive species
Full Name cell division cycle 25 homolog C (S. pombe)
Calculated Molecular Weight 473 aa, 53 kDa
Observed Molecular Weight 46-53 kDa
GenBank Accession NumberBC019089
Gene Symbol CDC25C
Gene ID (NCBI) 995
RRIDAB_2882239
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP30307
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The cell division cycle 25 (CDC25) family of proteins are highly conserved dual specificity phosphatases that activate cyclin-dependent kinase (CDK) complexes, which in turn regulate progression through the cell division cycle. CDC25C (cell division cycle 25 homolog C) is one of the 3 isoforms of CDC25 in mammalian cells. It is present in the cytoplasm of asynchronously growing human cells (PMID:10330186). And it may be phosphorylated by its own substrate, an active cdc2-cyclin B complex, to create an autoactivation loop (PMID:7937793). It can be hyperphosphorylated to get the active form of 70 kDa (PMID:18296513). CDC25C has some isofroms with molecular mass of 46-53 kDa.

Loading...
||
New chat Able
正在加载,请稍候...