CDC27; APC3 Monoclonal antibody, PBS Only

• 

  WB analysis of Jurkat using 67239-1-Ig (same clone as 67239-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 67239-1-Ig (CDC27; APC3 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67239-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HSC-T6 using 67239-1-Ig (same clone as 67239-1-PBS)

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 67239-1-Ig (CDC27; APC3 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67239-1-PBS in a different storage buffer formulation.

• 

  WB analysis of 4T1 using 67239-1-Ig (same clone as 67239-1-PBS)

  4T1 cells were subjected to SDS PAGE followed by western blot with 67239-1-Ig (CDC27; APC3 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67239-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 67239-1-Ig (same clone as 67239-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 67239-1-Ig (CDC27; APC3 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67239-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 67239-1-Ig (same clone as 67239-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67239-1-Ig (CDC27; APC3 antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67239-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 67239-1-Ig (same clone as 67239-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67239-1-Ig (CDC27; APC3 antibody) at dilution of 1:5000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67239-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human lung cancer using 67239-1-Ig (same clone as 67239-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human lung cancer tissue using CDC27; APC3 antibody (67239-1-Ig, Clone: 2F10G2 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67239-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human lung cancer using 67239-1-Ig (same clone as 67239-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human lung cancer tissue using CDC27; APC3 antibody (67239-1-Ig, Clone: 2F10G2 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67239-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 67239-1-Ig (same clone as 67239-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using CDC27; APC3 antibody (67239-1-Ig, Clone: 2F10G2 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67239-1-PBS in a different storage buffer formulation.

• 

  FC experiment of K-562 using 67239-1-Ig (same clone as 67239-1-PBS)

  1X10^6 K-562 cells were intracellularly stained with 0.4 ug Anti-Human CDC27; APC3 (67239-1-Ig, Clone:2F10G2) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG2b Isotype Control (MPC-11) (65128-1-Ig, Clone: MPC-11) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 67239-1-PBS in a different storage buffer formulation.

CDC27; APC3 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), Indirect ELISA

Cat No. 67239-1-PBS

Clone No.2F10G2

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), Indirect ELISA

Synonyms

CDC27, CDC27 homolog, APC3, APC 3, Anaphase-promoting complex subunit 3

---

Product Information

67239-1-PBS targets CDC27; APC3 in WB, IHC, IF/ICC, IF-P, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25588

  Product name: Recombinant human CDC27; APC3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 481-830 aa of BC011656

  Sequence: ALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF

• Full Name: cell division cycle 27 homolog (S. cerevisiae)
• Calculated Molecular Weight: 92 kDa
• Observed Molecular Weight: 90-100 kDa
• GenBank Accession Number: BC011656
• Gene Symbol: CDC27
• Gene ID (NCBI): 996
• RRID: AB_2882518
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P30260
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CDC27/APC3 is a component of the anaphase-promoting complex (APC/cyclosome), which is composed of eight subunits and highly conserved in eukaryotic cells. The APC/cyclosome complex acts as a cell cycle-regulated E3 ubiquitin ligase which mediates ubiquitination and subsequent degradation of target proteins, and lead to the progression control through mitosis and the G1 phase of the cell cycle.