CDK5RAP2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CDK5RAP2 Polyclonal antibody, PBS Only (31702-1-PBS)

• 

  WB analysis using 31702-1-AP (same clone as 31702-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31702-1-AP (CDK5RAP2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31702-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 31702-1-AP (same clone as 31702-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31702-1-AP (CDK5RAP2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31702-1-PBS in a different storage buffer formulation.

CDK5RAP2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31702-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

C48, CDK5 activator-binding protein C48, CDK5 regulatory subunit-associated protein 2, Centrosome-associated protein 215, CEP215

---

Product Information

31702-1-PBS targets CDK5RAP2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36245

  Product name: Recombinant human CDK5RAP2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1221-1571 aa of BC146782

  Sequence: MQLFSEIHNLQNKFRDLSPPRYDSLVQSQARELSLQRQQIKDGHGICVISRQHMNTMIKAFEELLQASDVDYCVAEGFQEQLNQCAELLEKLEKLFLNGKSVGVEMNTQNELMERIEEDNLTYQHLLPESPEPSASHALSDYETSEKSFFSRDQKQDNETEKTSVMVNSFSQDLLMEHIQEIRTLRKRLEESIKTNEKLRKQLERQGSEFVQGSTSIFASGSELHSSLTSEIHFLRKQNQALNAMLIKGSRDKQKENDKLRESLSRKTVSLEHLQREYASVKEENERLQKEGSEKERHNQQLIQEVRCSGQELSRVQEELKLRQQLLSQNDKLLQSLRVELKAYEKLDEEH

• Full Name: CDK5 regulatory subunit associated protein 2
• Calculated Molecular Weight: 1893 aa, 215 kDa
• Observed Molecular Weight: 210-215 kDa
• GenBank Accession Number: BC146782
• Gene Symbol: CDK5RAP2
• Gene ID (NCBI): 55755
• RRID: AB_3670087
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96SN8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cyclin-dependent kinase 5 regulatory subunit associated protein 2 (CDK5RAP2) is a pericentriolar matrix (PCM) protein that regulates centriole engagement and centrosome cohesion during the cell cycle. CDK5RAP2 is associated with several cancers, including breast cancer, oral squamous cell carcinoma and haematological malignancies.