Tested Applications
| Positive WB detected in | HeLa cells, HEK-293 cells, Jurkat cells, HepG2 cells, K-562 cells, HSC-T6 cells |
| Positive IP detected in | Jurkat cells |
| Positive IHC detected in | human lung cancer tissue, human gliomas tissue, human endometrial cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
19117-1-AP targets CDK6 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5600 Product name: Recombinant human CDK6 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-326 aa of BC027989 Sequence: MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA Predict reactive species |
| Full Name | cyclin-dependent kinase 6 |
| Calculated Molecular Weight | 326 aa, 36 kDa |
| Observed Molecular Weight | 36-40 kDa |
| GenBank Accession Number | BC027989 |
| Gene Symbol | CDK6 |
| Gene ID (NCBI) | 1021 |
| RRID | AB_10640575 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q00534 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CDK6(Cyclin-dependent kinase 6) is involved in initiation and maintenance of cell cycle exit during cell differentiation and it prevents cell proliferation and regulates negatively cell differentiation, but is required for the proliferation of specific cell types.The molecular weight of CDK6 is 36-40 KDa (PMID: 23563707, 8114739).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CDK6 antibody 19117-1-AP | Download protocol |
| IF protocol for CDK6 antibody 19117-1-AP | Download protocol |
| IHC protocol for CDK6 antibody 19117-1-AP | Download protocol |
| IP protocol for CDK6 antibody 19117-1-AP | Download protocol |
| WB protocol for CDK6 antibody 19117-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
CDK6 Polyclonal Antibody (Cat# 19117-1-AP) has accumulated 21 citations published in journals including Molecular Cell, Theranostics, Nature Cardiovascular Research, Cell Death & Disease, Oncotarget, Scientific Reports, Cancers, Cancer Medicine, Frontiers in Pharmacology, Oxidative Medicine and Cellular Longevity, and Onco Targets and Therapy. Research fields encompass cell cycle regulation, cancer biology (breast, lung, renal, pancreatic, glioblastoma, endometrial), DNA mismatch repair, cardiac regeneration, autophagy, EMT, and neuropharmacology.
| Species | Application | Title |
|---|---|---|
Theranostics Estrogen-induced circRNA, circPGR, functions as a ceRNA to promote estrogen receptor-positive breast cancer cell growth by regulating cell cycle-related genes. | ||
Nat Cardiovasc Res α-Ketoglutarate promotes cardiomyocyte proliferation and heart regeneration after myocardial infarction | ||
Cell Death Dis GLI1 reduces drug sensitivity by regulating cell cycle through PI3K/AKT/GSK3/CDK pathway in acute myeloid leukemia. | ||
Oxid Med Cell Longev P16INK4a Regulates ROS-Related Autophagy and CDK4/6-Mediated Proliferation: A New Target of Myocardial Regeneration Therapy | ||
Front Pharmacol Methamphetamine exposure drives cell cycle exit and aberrant differentiation in rat hippocampal-derived neurospheres |
