• Featured Product
  • KD/KO Validated

CoraLite® Plus 647-conjugated CDK6 Polyclonal antibody

CDK6 Polyclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL647-19117

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

CDKN6, Cell division protein kinase 6, Cyclin dependent kinase 6, Cyclin-dependent kinase 6, EC:2.7.11.22

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-19117 targets CDK6 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5600

Product name: Recombinant human CDK6 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-326 aa of BC027989

Sequence: MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA

Predict reactive species
Full Name cyclin-dependent kinase 6
Calculated Molecular Weight 326 aa, 36 kDa
Observed Molecular Weight 36-40 kDa
GenBank Accession NumberBC027989
Gene Symbol CDK6
Gene ID (NCBI) 1021
RRIDAB_2934934
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ00534
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CDK6(Cyclin-dependent kinase 6) is involved in initiation and maintenance of cell cycle exit during cell differentiation and it prevents cell proliferation and regulates negatively cell differentiation, but is required for the proliferation of specific cell types.The molecular weight of CDK6 is 36-40 KDa (PMID: 23563707, 8114739).

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 CDK6 antibody CL647-19117Download protocol
IF protocol for CL Plus 647 CDK6 antibody CL647-19117Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...