FcZero-rAb® APC-Cyanine7 Anti-Human CEACAM3/6 (CD66c/d) Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• FcZero-rAb® APC-Cyanine7 Anti-Human CEACAM3/6 (CD66c/d) Rabbit Recombinant Antibody (AY7-FcA98169)

• 

  FC experiment of human peripheral blood leukocyte using AY7-FcA98169

  1x10^6 human peripheral blood leukocyte were surface stained with 5 ul APC-Cyanine7 Anti-Human CEACAM3/6 (CD66c/d) Rabbit RecAb (AY7-FcA98169, Clone:241254D1) or FcZero-rAb® APC-Cyanine7 Rabbit IgG Isotype Control Recombinant Antibody (AY7-FcA98136, Clone: 240953C9). Cells were incubated with MonoZero™ Monocytes blocking Reagent (PF00020) prior to staining. Cells were not fixed.

• 

  FC experiment of human peripheral blood leukocyte using AY7-FcA98169

  1x10^6 human peripheral blood leukocyte were surface stained with 5 ul APC-Cyanine7 Anti-Human CEACAM3/6 (CD66c/d) Rabbit RecAb (AY7-FcA98169, Clone:241254D1) (red) or FcZero-rAb® APC-Cyanine7 Rabbit IgG Isotype Control Recombinant Antibody (AY7-FcA98136, Clone: 240953C9) (blue). Cells were incubated with MonoZero™ Monocytes blocking Reagent (PF00020) prior to staining. Cells were not fixed.

• Zero Fc receptor binding
• Site-specific conjugation
• One universal isotype

CEACAM3/6 (CD66c/d) FcZero-rAb^® Recombinant Antibody for FC

Cat No. AY7-FcA98169

Clone No.241254D1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

CD66c, CEACAM3/CD66d, CEACAM6, CEACAM6/CD66c, CEACAM3

---

Tested Applications

• Positive FC detected in: human peripheral blood leukocyte

Recommended dilution

• Flow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension

This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.

Sample-dependent, Check data in validation data gallery.

Product Information

AY7-FcA98169 targets CEACAM3/6 (CD66c/d) in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0144

  Product name: Recombinant Human CEACAM-3 protein (Myc Tag, His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: Myc & 6*His

  Domain: 35-155 aa of BC106728

  Sequence: KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG

• Full Name: carcinoembryonic antigen-related cell adhesion molecule 3
• Calculated Molecular Weight: 252 aa, 27 kDa
• GenBank Accession Number: BC106728
• Gene Symbol: CEACAM3
• Gene ID (NCBI): 1084
• Conjugate: APC-Cyanine7 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 650 nm / 778 nm
• Excitation Laser: Red Laser (633 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P40198
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Carcinoembryonic antigen-related cell adhesion molecules (CEACAMs) belong to the immunoglobulin superfamily of cell adhesion molecules. CEACAMs play major roles in cell-cell and cell-ECM adhesion and have been implicated in controlling cell proliferation, angiogenesis, and tissue remodeling (PMID: 23021083). CEACAM3, also named as CD66d and CGM1, is exclusively expressed on granulocytes and acts as the major granulocyte receptor mediating recognition and efficient opsonin-independent phagocytosis of CEACAM-binding microorganisms (PMID: 18606569). CEACAM6, also known as CD66c, is normally expressed on the surface of myeloid and epithelial surfaces and upregulated preferentially at the apical/luminal membranes of many tumors (PMID: 27595061; 35082925). This antibody is raised against 35-155 aa of human CEACAM3/CD66d and can cross-react with CEACAM6/CD66c.