Tested Applications
| Positive FC detected in | human peripheral blood leukocytes |
Recommended dilution
| Application | Dilution |
|---|---|
| Flow Cytometry (FC) | FC : 5 ul per 10^6 cells in a 100 µl suspension |
| This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CPY5-FcA98169 targets CEACAM3/6 (CD66c/d) in FC applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg0144 Product name: Recombinant Human CEACAM-3 protein (Myc Tag, His Tag) Source: mammalian cells-derived, pHZ-KIsec Tag: Myc & 6*His Domain: 35-155 aa of BC106728 Sequence: KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG Predict reactive species |
| Full Name | carcinoembryonic antigen-related cell adhesion molecule 3 |
| Calculated Molecular Weight | 252 aa, 27 kDa |
| GenBank Accession Number | BC106728 |
| Gene Symbol | CEACAM3 |
| Gene ID (NCBI) | 1084 |
| Conjugate | PerCP-Cyanine5.5 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 482 nm / 690nm |
| Excitation Laser | Blue laser (488 nm) |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P40198 |
| Storage Buffer | PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. |
Background Information
Carcinoembryonic antigen-related cell adhesion molecules (CEACAMs) belong to the immunoglobulin superfamily of cell adhesion molecules. CEACAMs play major roles in cell-cell and cell-ECM adhesion and have been implicated in controlling cell proliferation, angiogenesis, and tissue remodeling (PMID: 23021083). CEACAM3, also named as CD66d and CGM1, is exclusively expressed on granulocytes and acts as the major granulocyte receptor mediating recognition and efficient opsonin-independent phagocytosis of CEACAM-binding microorganisms (PMID: 18606569). CEACAM6, also known as CD66c, is normally expressed on the surface of myeloid and epithelial surfaces and upregulated preferentially at the apical/luminal membranes of many tumors (PMID: 27595061; 35082925). This antibody is raised against 35-155 aa of human CEACAM3/CD66d and can cross-react with CEACAM6/CD66c.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for PerCP-Cyanine5.5 CEACAM3/6 (CD66c/d) antibody CPY5-FcA98169 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



