CEBPB Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83791-6-RR (same clone as 83791-6-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83791-6-RR (CEBPB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83791-6-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovarian cancer using 83791-6-RR (same clone as 83791-6-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovarian cancer slide using 83791-6-RR (CEBPB antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83791-6-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 83791-6-RR (same clone as 83791-6-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CEBPB antibody (83791-6-RR, Clone: 240836G6 ) at dilution of 1:300 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 83791-6-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 83791-6-RR (same clone as 83791-6-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug CEBPB Recombinant antibody (83791-6-RR, Clone:240836G6) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with True-Nuclear Transcription Factor Buffer Set. This data was developed using the same antibody clone with 83791-6-PBS in a different storage buffer formulation.

• 

  ChIP experiment of NIH/3T3 using 83791-6-RR (same clone as 83791-6-PBS)

  Chromatin was prepared from NIH/3T3 cells. Cells were fixed with formaldehyde for 10 minutes. The ChIP was performed with 20 µg of cross-linked chromatin, 5 µg of CEBPB (83791-6-RR) or 5 ug of Normal Rabbit IgG (98136-1-RR), and 20 µl of Protein A Magarose Beads. The immunoprecipitated DNA was quantified by real-time PCR. This data was developed using the same antibody clone with 83791-6-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83791-6-RR

  Biolayer interferometry (BLl) kinetic assays of 83791-6-RR against Human CEBPB were performed. The affinity constant is 69.2 pM.

CEBPB Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA, ChIP-qPCR

Cat No. 83791-6-PBS

Clone No.240836G6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA, ChIP-qPCR

Synonyms

240836G6, C EBP beta, C/EBP beta, C/EBP related protein 2, C/EBPbeta

---

Product Information

83791-6-PBS targets CEBPB in WB, IHC, IF/ICC, FC (Intra), ELISA, ChIP-qPCR applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag20073

  Product name: Recombinant human CEBPB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-266 aa of BC007538

  Sequence: MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKT

• Full Name: CCAAT/enhancer binding protein (C/EBP), beta
• Calculated Molecular Weight: 345 aa, 36 kDa
• Observed Molecular Weight: 42 kDa, 46 kDa
• GenBank Accession Number: BC007538
• Gene Symbol: CEBPB
• Gene ID (NCBI): 1051
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P17676
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CCAAT/enhancer-binding protein beta (CEBPB), also known as LAP, is a important transcriptional activator in the regulation of genes involved in immune and inflammatory responses. It specifically binds to an IL-1 response element in the IL-6 gene. CEBPb mRNAs possess alternative translation-initiation codons, which result in the formation of truncated forms of the protein.Three variants of CEBPBs have been detected: a 46 kDa full-length liver-enriched transcription-activating protein (LAP1), a 42 kDa LAP2 and a 20 kDa liver-enriched transcription-inhibitory protein (LIP). (PMID:18820298).