CoraLite® Plus 488-conjugated CEP89, CCDC123 Monoclonal antibody

CEP89, CCDC123 Monoclonal Antibody for IF/ICC
Cat No. CL488-68112
Clone No.1F12C5

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse

Applications

IF/ICC

CCDC123, FLJ14640

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68112 targets CEP89, CCDC123 in IF/ICC applications and shows reactivity with Human, mouse samples.

Tested Reactivity Human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28339

Product name: Recombinant human CCDC123 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 248-343 aa of BC136328

Sequence: MDLNNMNQSLTLELNTMKQAMKELQLKLKGMEKEKRKLKEAEKASSQEVAAPELLYLRKQAQELVDENDGLKMTVHRLNVELSRYQTKFRHLSKEE

Predict reactive species
Full Name coiled-coil domain containing 123
Calculated Molecular Weight 783 aa, 90 kDa
Observed Molecular Weight90 kDa
GenBank Accession NumberBC136328
Gene Symbol CEP89
Gene ID (NCBI) 84902
RRIDAB_3084402
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ96ST8
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CCDC123 (as known as CEP123), also named as CEP89, encodes for a protein required for ciliogenesis. It plays a role in mitochondrial metabolism by modulating complex IV activity. It has been shown that CEP123 is localized to the distal appendages of the mother centriolecep and the localization of CEP123 is cell cycle-dependent with its levels decreasing during mitosis. CEP123 depletion can cause defects in ciliary vesicle formationcep and prevent the formation of a ciliary vesicle at the distal end of the mother centriole. It is possible that CEP123 is involved in regulating the recruitment of membranes to the centrosome through its interaction with CEP290 (PMID:23575228, 23789104, 23348840).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 CEP89, CCDC123 antibody CL488-68112Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...