Home
Products
Primary Antibodies
CEPT1 Polyclonal antibody, PBS Only (20496-1-PBS)

Filter: AllIHCIF/ICC

IHC staining of human liver using 20496-1-AP (same clone as 20496-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 20496-1-AP (CEPT1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20496-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 20496-1-AP (same clone as 20496-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 20496-1-AP (CEPT1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20496-1-PBS in a different storage buffer formulation.
IHC staining of human tonsillitis using 20496-1-AP (same clone as 20496-1-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 20496-1-AP (CEPT1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20496-1-PBS in a different storage buffer formulation.
IHC staining of human pancreas using 20496-1-AP (same clone as 20496-1-PBS)
Immunohistochemical analysis of paraffin-embedded human pancreas using 20496-1-AP (CEPT1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 20496-1-PBS in a different storage buffer formulation.
IHC staining of human pancreas using 20496-1-AP (same clone as 20496-1-PBS)
Immunohistochemical analysis of paraffin-embedded human pancreas using 20496-1-AP (CEPT1 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 20496-1-PBS in a different storage buffer formulation.
IHC staining of human cervical cancer using 20496-1-AP (same clone as 20496-1-PBS)
Immunohistochemical analysis of paraffin-embedded human cervical cancer using 20496-1-AP (CEPT1 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 20496-1-PBS in a different storage buffer formulation.
IHC staining of human cervical cancer using 20496-1-AP (same clone as 20496-1-PBS)
Immunohistochemical analysis of paraffin-embedded human cervical cancer using 20496-1-AP (CEPT1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 20496-1-PBS in a different storage buffer formulation.
IF Staining of HepG2 using 20496-1-AP (same clone as 20496-1-PBS)
Immunofluorescent analysis of HepG2 cells, using CEPT1 antibody 20496-1-AP at 1:25 dilution and FITC- labeled goat anti-Rabbit IgG (green). This data was developed using the same antibody clone with 20496-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

CEPT1 Polyclonal antibody, PBS Only

Name: CEPT1 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 20496-1-PBS

CEPT1 Polyclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 20496-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

1-alkenyl-2-acylglycerol choline phosphotransferase, choline/ethanolamine phosphotransferase 1, EC:2.7.8.1, EC:2.7.8.22, hCEPT1

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

20496-1-PBS targets CEPT1 in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag14140 Product name: Recombinant human CEPT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-91 aa of BC032610 Sequence: MSGHRSTRKRCGDSHPESPVGFGHMSTTGCVLNKLFQLPTPPLSRHQLKRLEEHRYQSAGRSLLEPLMQGYWEWLVRRVPSWIAPNLITII Predict reactive species
Full Name	choline/ethanolamine phosphotransferase 1
Calculated Molecular Weight	416 aa, 47 kDa
GenBank Accession Number	BC032610
Gene Symbol	CEPT1
Gene ID (NCBI)	10390
RRID	AB_10694283
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9Y6K0
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Choline-enthanolamine phosphotransferase 1 (CEPT1) is a 47-kDa membrane-bound protein that catalyzes the terminal step of the Kennedy pathway. CEPT1 is encoded by the Cept1 gene and is responsible for phosphatidylcholine (PC) and phosphatidylethanolamine (PE) production (PMID: 33214136, 30030520).