Product Information
20496-1-PBS targets CEPT1 in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14140 Product name: Recombinant human CEPT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-91 aa of BC032610 Sequence: MSGHRSTRKRCGDSHPESPVGFGHMSTTGCVLNKLFQLPTPPLSRHQLKRLEEHRYQSAGRSLLEPLMQGYWEWLVRRVPSWIAPNLITII Predict reactive species |
| Full Name | choline/ethanolamine phosphotransferase 1 |
| Calculated Molecular Weight | 416 aa, 47 kDa |
| GenBank Accession Number | BC032610 |
| Gene Symbol | CEPT1 |
| Gene ID (NCBI) | 10390 |
| RRID | AB_10694283 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y6K0 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Choline-enthanolamine phosphotransferase 1 (CEPT1) is a 47-kDa membrane-bound protein that catalyzes the terminal step of the Kennedy pathway. CEPT1 is encoded by the Cept1 gene and is responsible for phosphatidylcholine (PC) and phosphatidylethanolamine (PE) production (PMID: 33214136, 30030520).















