CHD2 Polyclonal antibody

• 

  WB analysis using 21334-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21334-1-AP (CHD2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 21334-1-AP

  WB result of CHD2 antibody (21334-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CHD2 transfected HEK-293 cells.

• 

  IHC staining of mouse testis using 21334-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 21334-1-AP (CHD2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 21334-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 21334-1-AP (CHD2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 21334-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 21334-1-AP (CHD2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 21334-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 21334-1-AP (CHD2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 21334-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CHD2 antibody (21334-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

• 

  IF Staining of HeLa using 21334-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CHD2 antibody (21334-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

CHD2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 21334-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

EC:3.6.4.12, Chromodomain-helicase-DNA-binding protein 2, CHD-2, CHD 2, ATP-dependent helicase CHD2

---

Tested Applications

• Positive WB detected in: HEK-293 cells, Jurkat cells, K-562 cells
• Positive IHC detected in: rat brain tissue, mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21334-1-AP targets CHD2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15429

  Product name: Recombinant human CHD2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-230 aa of BC020810

  Sequence: MMRNKDKSQEEDSSLHSNASSHSASEEASGSDSGSQSESEQGSDPGSGHGSESNSSSESSESQSESESESAGSKSQPVLPEAKEKPASKKERIADVKKMWEEYPDVYGVRRSNRSRQEPSRFNIKEEASSGSESGSPKRRGQRQLKKQEKWKQEPSEDEQEQGTSAESEPEQKKVKARRPVPRRTVPKPRVKKQPKTQRGKRKKQDSSDEDDDDDEVPKRQTRRRAAKNV

• Full Name: chromodomain helicase DNA binding protein 2
• Calculated Molecular Weight: 1828 aa, 211 kDa
• Observed Molecular Weight: 230-250 kDa
• GenBank Accession Number: BC020810
• Gene Symbol: CHD2
• Gene ID (NCBI): 1106
• RRID: AB_3085652
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14647
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Chromodomain helicase DNA binding protein 2 (CHD2), a member of the sucrose nonfermenting (SNF-2) protein family of epigenetic regulators, which use the energy from ATP hydrolysis to change nucleosome positioning, composition and chromatin structure(PMID: 33435571). CHD2 protein plays a critical role in embryonic development, tumor suppression and survival(PMID: 24834135). In addition, CHD2 has been proposed to prevent breast cancer initiation, and CHD2 mutations are associated with chronic lymphocytic leukemia.

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Raquel (Verified Customer) (07-12-2024)

Nice and clean staining. Immunofluorescence analysis in cryostat sections of 4% PFA fixed human brain organoid derived from iPSCs using 21334-1-AP Chd2 antibody at dilution of 1:100 (under 20x lens). (Magenta: Chd2 ; Blue: DAPI)

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:200
• Cell Tissue Type: Human Brain Organoids

CHD2 Antibody Immunofluorescence validation (1:200 dilution) in Human Brain Organoids (Cat no:21334-1-AP)