CHD2 Polyclonal antibody, PBS Only

• 

  WB analysis using 21334-1-AP (same clone as 21334-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21334-1-AP (CHD2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21334-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 21334-1-AP (same clone as 21334-1-PBS)

  WB result of CHD2 antibody (21334-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CHD2 transfected HEK-293 cells. This data was developed using the same antibody clone with 21334-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 21334-1-AP (same clone as 21334-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 21334-1-AP (CHD2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21334-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 21334-1-AP (same clone as 21334-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 21334-1-AP (CHD2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21334-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 21334-1-AP (same clone as 21334-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 21334-1-AP (CHD2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21334-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 21334-1-AP (same clone as 21334-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 21334-1-AP (CHD2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21334-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 21334-1-AP (same clone as 21334-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CHD2 antibody (21334-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 21334-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 21334-1-AP (same clone as 21334-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CHD2 antibody (21334-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 21334-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CHD2 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 21334-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

ATP-dependent helicase CHD2, CHD 2, CHD-2, Chromodomain-helicase-DNA-binding protein 2, EC:3.6.4.12

---

Product Information

21334-1-PBS targets CHD2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15429

  Product name: Recombinant human CHD2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-230 aa of BC020810

  Sequence: MMRNKDKSQEEDSSLHSNASSHSASEEASGSDSGSQSESEQGSDPGSGHGSESNSSSESSESQSESESESAGSKSQPVLPEAKEKPASKKERIADVKKMWEEYPDVYGVRRSNRSRQEPSRFNIKEEASSGSESGSPKRRGQRQLKKQEKWKQEPSEDEQEQGTSAESEPEQKKVKARRPVPRRTVPKPRVKKQPKTQRGKRKKQDSSDEDDDDDEVPKRQTRRRAAKNV

• Full Name: chromodomain helicase DNA binding protein 2
• Calculated Molecular Weight: 1828 aa, 211 kDa
• Observed Molecular Weight: 230-250 kDa
• GenBank Accession Number: BC020810
• Gene Symbol: CHD2
• Gene ID (NCBI): 1106
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14647
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Chromodomain helicase DNA binding protein 2 (CHD2), a member of the sucrose nonfermenting (SNF-2) protein family of epigenetic regulators, which use the energy from ATP hydrolysis to change nucleosome positioning, composition and chromatin structure(PMID: 33435571). CHD2 protein plays a critical role in embryonic development, tumor suppression and survival(PMID: 24834135). In addition, CHD2 has been proposed to prevent breast cancer initiation, and CHD2 mutations are associated with chronic lymphocytic leukemia.