CHDH Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CHDH Polyclonal antibody, PBS Only (17356-1-PBS)

• 

  WB analysis using 17356-1-AP (same clone as 17356-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17356-1-AP (CHDH antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17356-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 17356-1-AP (same clone as 17356-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 17356-1-AP (CHDH antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17356-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 17356-1-AP (same clone as 17356-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 17356-1-AP (CHDH antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17356-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 17356-1-AP (same clone as 17356-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 17356-1-AP (CHDH antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 17356-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 17356-1-AP (same clone as 17356-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 17356-1-AP (CHDH antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 17356-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CHDH Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 17356-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

17356-1-PBS targets CHDH in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10614

  Product name: Recombinant human CHDH protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 244-594 aa of BC034502

  Sequence: YLHPALSRTNLKAEAETLVSRVLFEGTRAVGVEYVKNGQSHRAYASKEVILSGGAINSPQLLMLSGIGNADDLKKLGIPVVCHLPGVGQNLQDHLEIYIQQACTRPITLHSAQKPLRKVCIGLEWLWKFTGEGATAHLETGGFIRSQPGVPHPDIQFHFLPSQVIDHGRVPTQQEAYQVHVGPMRGTSVGWLKLRSANPQDHPVIQPNYLSTETDIEDFRLCVKLTREIFAQEALAPFRGKELQPGSHIQSDKEIDAFVRAKADSAYHPSCTCKMGQPSDPTAVVDPQTRVLGVENLRVVDASIMPSMVSGNLNAPTIMIAEKAADIIKGQPALWDKDVPVYKPRTLATQR

• Full Name: choline dehydrogenase
• Calculated Molecular Weight: 594 aa, 65 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC034502
• Gene Symbol: CHDH
• Gene ID (NCBI): 55349
• RRID: AB_2276253
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NE62
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CHDH(Choline dehydrogenase, mitochondrial) is also named as CDH,CHD and belongs to the GMC oxidoreductase family. CHDH is a member of the glucose-methanol-choline family of oxidoreductases, with each member containing a consensus FAD-binding domain. Many members of this oxidoreductase family are soluble proteins but mammalian CHDH is associated with the inner mitochondrial membrane(Handbook of vitamins,Robert B,2007). The full length protein(65 kDa) has a transit peptide of 29 amino acid and the mature CHDH is appropriately located in the inner mitochondria membrane(PMID:12951056). 17356-1-AP can also recognize the 45 kDa isoform X3 of CHDH.