CHI3L2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CHI3L2 Polyclonal antibody, PBS Only (27363-1-PBS)

• 

  WB analysis using 27363-1-AP (same clone as 27363-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27363-1-AP (CHI3L2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27363-1-PBS in a different storage buffer formulation.

• 

  WB analysis of U-87 MG using 27363-1-AP (same clone as 27363-1-PBS)

  WB result of CHI3L2 antibody (27363-1-AP; 1:400; incubated at room temperature for 1.5 hours) with sh-Control and sh-CHI3L2 transfected U-87 MG cells. This data was developed using the same antibody clone with 27363-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CHI3L2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 27363-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

CHI3 L2, chitinase 3 like 2, Chitinase-3-like protein 2, YKL39, YKL-39

---

Product Information

27363-1-PBS targets CHI3L2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26386

  Product name: Recombinant human CHI3L2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 37-174 aa of BC011460

  Sequence: SQDRQEPGKFTPENIDPFLCSHLIYSFASIENNKVIIKDKSEVMLYQTINSLKTKNPKLKILLSIGGYLFGSKGFHPMVDSSTSRLEFINSIILFLRNHNFDGLDVSWIYPDQKENTHFTVLIHELAEAFQKDFTKST

• Full Name: chitinase 3-like 2
• Calculated Molecular Weight: 390 aa, 44 kDa
• Observed Molecular Weight: 44-48 kDa
• GenBank Accession Number: BC011460
• Gene Symbol: CHI3L2
• Gene ID (NCBI): 1117
• RRID: AB_3669597
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15782
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CHI3L2 (Chitinase-3-Like Protein 2), also known as YKL-39, is a member of the chitinase-like protein family, which belongs to the glycoside hydrolase 18 family. CHI3L2 is primarily involved in cartilage biogenesis and tissue remodeling. It is highly expressed in certain tissues, including the appendix and salivary glands.