Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CoraLite® Plus 647-conjugated CHRNA9 Polyclonal antibody

CHRNA9 Polyclonal Antibody for FC (Intra), ELISA

Cat No. CL647-26025

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

FC (Intra), ELISA

HSA243342, NACHR alpha 9, NACHR alpha-9, NACHRA9, Neuronal acetylcholine receptor subunit alpha-9

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inRAW 264.7 cells, Jurkat cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.4 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-26025 targets CHRNA9 in FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag23272

Product name: Recombinant human CHRNA9 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 324-479 aa of BC113549

Sequence: HFCGAEARPVPHWARVVILKYMSRVLFVYDVGESCLSPHHSRERDHLTKVYSKLPESNLKAARNKDLSRKKDMNKRLKNDLGCQGKNPQEAESYCAQYKVLTRNIEYIAKCLKDHKATSSKGSEWKKVAKVIDRFFMWIFFIMVFVMTILIIARAD

Predict reactive species
Full Name cholinergic receptor, nicotinic, alpha 9
Calculated Molecular Weight 479 aa, 55 kDa
Observed Molecular Weight 50-55 kDa
GenBank Accession NumberBC113549
Gene Symbol CHRNA9
Gene ID (NCBI) 55584
RRIDAB_3748528
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UGM1
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CHRNA9 (nicotinic α9 subunit of cholinergic receptor) gene is located in zone 4 (4p14) of short arm 1 of human chromosome 4, encoding a ligand-gated divalent cation channel protein, belonging to the nicotinic acetylcholine receptor (nAChR) superfamily. This subunit can be combined with CHRNA10 subunit to form a heteropentamer or a homopentamer, which is mainly distributed in cochlear outer hair cells, dorsal root ganglion, keratinocytes and immune cells.

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 CHRNA9 antibody CL647-26025Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...