CoraLite® Plus 647-conjugated CHRNA9 Polyclonal antibody

• 

  FC experiment of RAW 264.7 using CL647-26025

  1x10^6 RAW 264.7 cells were intracellularly stained with 0.4 ug CoraLite® Plus 647-conjugated CHRNA9 Polyclonal antibody (CL647-26025)(red), or 0.4 ug Isotype Control (blue). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

• 

  FC experiment of Jurkat using CL647-26025

  1x10^6 Jurkat cells were intracellularly stained with 0.4 ug CoraLite® Plus 647-conjugated CHRNA9 Polyclonal antibody (CL647-26025)(red), or 0.4 ug Isotype Control (blue). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

• Featured Product
• KD/KO Validated

CHRNA9 Polyclonal Antibody for ELISA

Cat No. CL647-26025

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

ELISA

Synonyms

HSA243342, NACHR alpha 9, NACHR alpha-9, NACHRA9, Neuronal acetylcholine receptor subunit alpha-9

---

Tested Applications

• Positive FC (Intra) detected in: RAW 264.7 cells, Jurkat cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.4 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-26025 targets CHRNA9 in ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23272

  Product name: Recombinant human CHRNA9 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 324-479 aa of BC113549

  Sequence: HFCGAEARPVPHWARVVILKYMSRVLFVYDVGESCLSPHHSRERDHLTKVYSKLPESNLKAARNKDLSRKKDMNKRLKNDLGCQGKNPQEAESYCAQYKVLTRNIEYIAKCLKDHKATSSKGSEWKKVAKVIDRFFMWIFFIMVFVMTILIIARAD

• Full Name: cholinergic receptor, nicotinic, alpha 9
• Calculated Molecular Weight: 479 aa, 55 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC113549
• Gene Symbol: CHRNA9
• Gene ID (NCBI): 55584
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UGM1
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.