CHTF8 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CHTF8 Polyclonal antibody, PBS Only (33030-1-PBS)

• 

  WB analysis using 33030-1-AP (same clone as 33030-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33030-1-AP (CHTF8 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33030-1-PBS in a different storage buffer formulation.

CHTF8 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33030-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Chromosome transmission fidelity protein 8 homolog, CTF8, hCTF8

---

Product Information

33030-1-PBS targets CHTF8 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag39083

  Product name: Recombinant human CHTF8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-121 aa of BC018700

  Sequence: MVQIVISSARAGGLAEWVLMELQGEIEARYSTGLAGNLLGDLHYTTEGIPVLIVGHHILYGKIIHLEKPFAVLVKHTPGDQDCDELGRETGTRYLVTALIKDKILFKTRPKPIITSVPKKV

• Full Name: CTF8, chromosome transmission fidelity factor 8 homolog (S. cerevisiae)
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC018700
• Gene Symbol: CHTF8
• Gene ID (NCBI): 54921
• RRID: AB_3742827
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P0CG13
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CHTF8 (C-terminal binding protein Transcriptional co-Factor 8) is a crucial protein that serves as a core component of the chromatin assembly factor-1 (CAF-1) complex.