CoraLite® Plus 488-conjugated CITED1 Polyclonal antibody

CITED1 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-26999

Host / Isotype

Rabbit / IgG

Reactivity

human, rat, mouse

Applications

IF/ICC, FC (Intra)

CITED1, Melanocyte specific protein 1, MSG1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHEK-293 cells
Positive FC (Intra) detected inHEK-293T cells
Positive FC detected inHEK-293T cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
Flow Cytometry (FC)FC : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-26999 targets CITED1 in IF/ICC, FC (Intra) applications and shows reactivity with human, rat, mouse samples.

Tested Reactivity human, rat, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag24643

Product name: Recombinant human CITED1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-151 aa of BC004240

Sequence: MPTTSRPALDVKGGTSPAKEDANQEMSSVAYSNLAVKDRKAVAILHYPGVASNGTKASGAPTSSSGSPIGSPTTTPPTKPPSFNLHPAPHLLASMQLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSAGAQSPAIIDSD

Predict reactive species
Full Name Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1
Calculated Molecular Weight 27 kDa
Observed Molecular Weight 30 kDa
GenBank Accession NumberBC004240
Gene Symbol CITED1
Gene ID (NCBI) 4435
RRIDAB_2919211
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ99966
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CITED1, also named as MSG1, belongs to the CITED family. CITED1 is a bifunctional transcriptional cofactor which is able to activate or repress transcription in association with other transcription factors. The CITED1 gene encodes a 27 kDa protein, but a 30 kDa band was also detected in the publication. The elevation of CITED1 may be directly associated with the preneoplastic phenotype (PMID: 23935526, 15272279, 15843474).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 CITED1 antibody CL488-26999Download protocol
IF protocol for CL Plus 488 CITED1 antibody CL488-26999Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...