• Featured Product
  • KD/KO Validated

CKB-Specific Recombinant monoclonal antibody, PBS Only (Capture)

CKB-Specific Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), Sandwich ELISA, Indirect ELISA
Cat No. 83522-5-PBS
Clone No.240418D2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), Sandwich ELISA, Indirect ELISA

CKB, KCRB, 240418D2, B CK, B-CK

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83522-5-PBS targets CKB-Specific as part of a matched antibody pair:

MP00504-4: 83522-5-PBS capture and 83522-6-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag7285

Product name: Recombinant human CKB protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-381 aa of BC001190

Sequence: MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK

Predict reactive species
Full Name creatine kinase, brain
Calculated Molecular Weight 43 kDa
Observed Molecular Weight 40-45 kDa
GenBank Accession NumberBC001190
Gene Symbol CKB
Gene ID (NCBI) 1152
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP12277
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CKBB, also named as B-CK and CKB, is a member of the ATP:guanido phosphotransferase protein family. It is a cytoplasmic enzyme involved in energy homeostasis. CKBB reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in brain as well as in other tissues, and as a heterodimer with a similar muscle isozyme in heart. CK isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa. CK MB consists of a dimer of nonidentical chains. With MM being the major form in skeletal muscle and myocardium, MB existing in myocardium, and BB existing in many tissues, especially brain.

Loading...
||
New chat

Able

正在加载,请稍候...