CKB-Specific Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 83522-5-RR (same clone as 83522-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83522-5-RR (CKB-Specific antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83522-5-PBS in a different storage buffer formulation.

• 

  WB analysis of HAP1 using 83522-5-RR (same clone as 83522-5-PBS)

  WB result of sg-CKB-Specific antibody (83522-5-RR; 1:10000; room temperature for 1.5 hours) with wild-type and sg-CKB-Specific transfected HAP1 cells. This data was developed using the same antibody clone with 83522-5-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA sample test of MP00504-4

  The mean CKB concentration was determined to be 138.08 ng/mL in MCF-7 cell extract based on a 1.20 mg/mL extract load, 159.52 ng/mL in HeLa cell extract based on a 1.30 mg/mL extract load, 161.58 ng/mL in mouse brain tissue extract based on a 6.60 mg/mL extract load and 200.17 ng/mL in rat brain tissue extract based on a 8.20 mg/mL extract load.

• 

  Sandwich ELISA standard curve of MP00504-4

  Sandwich ELISA standard curve of MP00504-4, Human CKB Recombinant Matched Antibody Pair - PBS only. 83522-5-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag7285. 83522-6-PBS was HRP conjugated as the detection antibody. Range: 1.56-50 ng/mL.

• 

  IHC staining of human colon cancer using 83522-5-RR (same clone as 83522-5-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 83522-5-RR (CKB-Specific antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83522-5-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 83522-5-RR (same clone as 83522-5-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug CKB-Specific Recombinant Antibody (83522-5-RR, Clone:240418D2) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83522-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83522-5-PBS

  Biolayer interferometry (BLl) kinetic assay of 83522-5-PBS against Human CKB-Specific was performed. The affinity constant is 1.54 nM.

• 

  Affinity and Kinetic Characterization of 83522-5-RR

  Biolayer interferometry (BLl) kinetic assays of 83522-5-RR against Human CKB were performed. The affinity constant is below 1 pM.

• Featured Product
• KD/KO Validated

CKB-Specific Uni-rAb^® Recombinant Antibody for WB, IHC, FC (Intra), Sandwich ELISA, Indirect ELISA

Cat No. 83522-5-PBS

Clone No.240418D2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), Sandwich ELISA, Indirect ELISA

Synonyms

CKB, KCRB, 240418D2, B CK, B-CK

---

Product Information

83522-5-PBS targets CKB-Specific as part of a matched antibody pair:

MP00504-4: 83522-5-PBS capture and 83522-6-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7285

  Product name: Recombinant human CKB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-381 aa of BC001190

  Sequence: MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK

• Full Name: creatine kinase, brain
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 40-45 kDa
• GenBank Accession Number: BC001190
• Gene Symbol: CKB
• Gene ID (NCBI): 1152
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P12277
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CKBB, also named as B-CK and CKB, is a member of the ATP:guanido phosphotransferase protein family. It is a cytoplasmic enzyme involved in energy homeostasis. CKBB reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in brain as well as in other tissues, and as a heterodimer with a similar muscle isozyme in heart. CK isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa. CK MB consists of a dimer of nonidentical chains. With MM being the major form in skeletal muscle and myocardium, MB existing in myocardium, and BB existing in many tissues, especially brain.