CKB-Specific Recombinant monoclonal antibody

• 

  WB analysis using 83522-5-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83522-5-RR (CKB-Specific antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HAP1 using 83522-5-RR

  WB result of sg-CKB-Specific antibody (83522-5-RR; 1:10000; room temperature for 1.5 hours) with wild-type and sg-CKB-Specific transfected HAP1 cells.

• 

  IHC staining of human colon cancer using 83522-5-RR

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 83522-5-RR (CKB-Specific antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  FC experiment of HeLa using 83522-5-RR

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug CKB-Specific Recombinant Antibody (83522-5-RR, Clone:240418D2) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  Affinity and Kinetic Characterization of 83522-5-RR

  Biolayer interferometry (BLl) kinetic assays of 83522-5-RR against Human CKB were performed. The affinity constant is below 1 pM.

• Featured Product
• KD/KO Validated

CKB-Specific Uni-rAb^® Recombinant Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 83522-5-RR

Clone No.240418D2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), ELISA

Synonyms

CKB, KCRB, 240418D2, B CK, B-CK

---

Tested Applications

• Positive WB detected in: HeLa cells, HAP1 cells, SH-SY5Y cells, Y79 cells, mouse brain tissue, rat brain tissue
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:100-1:1000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83522-5-RR targets CKB-Specific in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7285

  Product name: Recombinant human CKB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-381 aa of BC001190

  Sequence: MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK

• Full Name: creatine kinase, brain
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 40-45 kDa
• GenBank Accession Number: BC001190
• Gene Symbol: CKB
• Gene ID (NCBI): 1152
• RRID: AB_3671149
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P12277
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CKBB, also named as B-CK and CKB, is a member of the ATP:guanido phosphotransferase protein family. It is a cytoplasmic enzyme involved in energy homeostasis. CKBB reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in brain as well as in other tissues, and as a heterodimer with a similar muscle isozyme in heart. CK isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa. CK MB consists of a dimer of nonidentical chains. With MM being the major form in skeletal muscle and myocardium, MB existing in myocardium, and BB existing in many tissues, especially brain.