CKMT1A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CKMT1A Polyclonal antibody, PBS Only (15346-1-PBS)

• 

  WB analysis of HEK-293 using 15346-1-AP (same clone as 15346-1-PBS)

  WB result of CKMT1A antibody (15346-1-AP; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CKMT1A transfected HEK-293 cells. This data was developed using the same antibody clone with 15346-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat heart using 15346-1-AP (same clone as 15346-1-PBS)

  rat heart tissue were subjected to SDS PAGE followed by western blot with 15346-1-AP (CKMT1A Antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15346-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 cells using 15346-1-AP (same clone as 15346-1-PBS)

  A549 cells (shcontrol and shRNA of CKMT1A) were subjected to SDS PAGE followed by western blot with 15346-1-AP (CKMT1A antibody) at dilution of 1:30. This data was developed using the same antibody clone with 15346-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human colon using 15346-1-AP (same clone as 15346-1-PBS)

  human colon tissue were subjected to SDS PAGE followed by western blot with 15346-1-AP (CKMT1A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15346-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human testis using 15346-1-AP (same clone as 15346-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 15346-1-AP (CKMT1A antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15346-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse heart using 15346-1-AP (same clone as 15346-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 15346-1-AP (CKMT1A antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15346-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 15346-1-AP (same clone as 15346-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 15346-1-AP (CKMT1A Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15346-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 15346-1-AP (same clone as 15346-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 15346-1-AP (CKMT1A Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15346-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse heart using 15346-1-AP (same clone as 15346-1-PBS)

  IP result of anti-CKMT1A (IP:15346-1-AP, 4ug; Detection:15346-1-AP 1:1000) with mouse heart tissue lysate 3200ug. This data was developed using the same antibody clone with 15346-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 15346-1-AP (same clone as 15346-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 15346-1-AP (CKMT1A antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15346-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 15346-1-AP (same clone as 15346-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15346-1-AP (CKMT1A antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15346-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CKMT1A Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 15346-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

Creatine kinase U-type, mitochondrial, CKMT1B, CKMT1, CKMT, CKMiMi

---

Product Information

15346-1-PBS targets CKMT1A in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7583

  Product name: Recombinant human CKMT1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 41-417 aa of BC001926

  Sequence: SERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKHTTDLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH

• Full Name: creatine kinase, mitochondrial 1A
• Calculated Molecular Weight: 47 kDa
• Observed Molecular Weight: 40-50 kDa
• GenBank Accession Number: BC001926
• Gene Symbol: CKMT1A
• Gene ID (NCBI): 548596
• RRID: AB_2081073
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P12532
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CKMT1A(Creatine kinase U-type, mitochondrial) is also named CKMT and belongs to the ATP:guanido phosphotransferase family. CKMT1A is a nearly identical copy of the CKMT1B gene. Both genes encode an identical CKMT1 protein(PMID:17098888). It reversibly catalyzes the transfer of phosphate between ATP and various phosphates. It has 2 isoforms produced by alternative splicing with the molecular weight of 47 kDa and 50 kDa.