CKMT2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 87517-1-RR (same clone as 87517-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87517-1-RR (CKMT2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87517-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 87517-1-RR (same clone as 87517-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87517-1-RR (CKMT2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87517-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293T using 87517-1-RR (same clone as 87517-1-PBS)

  HEK-293T cells were subjected to SDS PAGE followed by western blot with 87517-1-RR (CKMT2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87517-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse heart using 87517-1-RR (same clone as 87517-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 87517-1-RR (CKMT2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87517-1-PBS in a different storage buffer formulation.

CKMT2 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87517-1-PBS

Clone No.252920F5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Basic-type mitochondrial creatine kinase, CKMT 2, Creatine kinase S-type, mitochondrial, EC:2.7.3.2, Mib CK

---

Product Information

87517-1-PBS targets CKMT2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3971

  Product name: Recombinant human CKMT2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 57-419 aa of BC029140

  Sequence: LRKHNNCMAECLTPAIYAKLRNKVTPNGYTLDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFADLFDPVIKLRHNGYDPRVMKHTTDLDASKITQGQFDEHYVLSSRVRTGRSIRGLSLPPACTRAERREVENVAITALEGLKGDLAGRYYKLSEMTEQDQQRLIDDHFLFDKPVSPLLTCAGMARDWPDARGIWHNYDKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHVRIPKLSKDPRFSKILENLRLQKRGTGGVDTAAVADVYDISNIDRIGRSEVELVQIVIDGVNYLVDCEKKLERGQDIKVPPPLPQFGKK

• Full Name: creatine kinase, mitochondrial 2 (sarcomeric)
• Calculated Molecular Weight: 419 aa, 48 kDa
• Observed Molecular Weight: 41-48 kDa
• GenBank Accession Number: BC029140
• Gene Symbol: CKMT2
• Gene ID (NCBI): 1160
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P17540
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CKMT2 (Creatine kinase S-type, mitochondrial), also known as s-MtCK, is one of the creatine kinase (CK) isozymes that are tightly coupled to adenosine triphosphate (ATP) output via adenine nucleotide transport proteins or carriers, making it an important player in ATP synthesis and respiratory chain activity (PMID: 38172162). Enhancing Ckmt2 expression or activity can protect against myocardial injury caused by ischemia-reperfusion injury (PMID: 39457679).