CLEC5A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CLEC5A Polyclonal antibody, PBS Only (18248-1-PBS)

• 

  WB analysis using 18248-1-AP (same clone as 18248-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 18248-1-AP (CLEC5A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18248-1-PBS in a different storage buffer formulation.

CLEC5A Polyclonal Antibody for WB, Indirect ELISA

Cat No. 18248-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

MDL-1, MDL1, MDL 1, C-type lectin superfamily member 5, C-type lectin domain family 5 member A

---

Product Information

18248-1-PBS targets CLEC5A in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13025

  Product name: Recombinant human CLEC5A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 32-188 aa of BC112099

  Sequence: NKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK

• Full Name: C-type lectin domain family 5, member A
• Calculated Molecular Weight: 188 aa, 22 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC112099
• Gene Symbol: CLEC5A
• Gene ID (NCBI): 23601
• RRID: AB_3741950
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NY25
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

C-type lectin domain family 5 member A (CLEC5A, also known as CLECSF5 and MDL1) is a spleen tyrosine kinase (Syk)-coupled receptor abundantly expressed by monocytes, macrophages and neutrophils (PMID: 10449773). It has a pivotal function in activating multiple aspects of innate immunity against bacterial invasion (PMID: 28824166). Both in vitro and in vivo evidence supported that CLEC5A was involved in glioblastoma pathogenesis via regulation of PI3K/Akt pathway (PMID: 30834619). It appeared as a protein band of ~36 kDa because of glycosylation, while its predicted molecular weight is 22 kDa (PMID: 25877931; 19074552).