CLK1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CLK1 Polyclonal antibody, PBS Only (20439-1-PBS)

• 

  WB analysis using 20439-1-AP (same clone as 20439-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20439-1-AP (CLK1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20439-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 20439-1-AP (same clone as 20439-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20439-1-AP (CLK1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20439-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 20439-1-AP (same clone as 20439-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 20439-1-AP (CLK1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20439-1-PBS in a different storage buffer formulation.

• 

  WB analysis of COLO 320 using 20439-1-AP (same clone as 20439-1-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 20439-1-AP (CLK1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20439-1-PBS in a different storage buffer formulation.

• 

  IP experiment of COLO 320 using 20439-1-AP (same clone as 20439-1-PBS)

  IP result of anti-CLK1 (IP:20439-1-AP, 4ug; Detection:20439-1-AP 1:300) with COLO 320 cells lysate 2000ug. This data was developed using the same antibody clone with 20439-1-PBS in a different storage buffer formulation.

CLK1 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 20439-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, Indirect ELISA

Synonyms

CDC-like kinase 1, CLK, EC:2.7.12.1, STY

---

Product Information

20439-1-PBS targets CLK1 in WB, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14214

  Product name: Recombinant human CLK1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-143 aa of BC031549

  Sequence: MRHSKRTYCPDWDDKDWDYGKWRSSSSHKRRKRSHSSAQENKRCKYNHSKMCDSHYLESRSINEKDYHSRRYIDEYRNDYTQGCEPGHRQRDHESRYQNHSSKSSGRSGRSSYKSKHRIHHSTSHRRSHGKSHRRKRTRSVED

• Full Name: CDC-like kinase 1
• Calculated Molecular Weight: 484 aa, 57 kDa
• Observed Molecular Weight: 62 kDa
• GenBank Accession Number: BC031549
• Gene Symbol: CLK1
• Gene ID (NCBI): 1195
• RRID: AB_2878686
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P49759
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CLK1 (CDC-like kinase 1) is the dual specificity kinase acting on both serine/threonine and tyrosine-containing substrates. It phosphorylates serine- and arginine-rich (SR) proteins of the spliceosomal complex and may be a constituent of a network of regulatory mechanisms that enable SR proteins to control RNA splicing. It can phosphorylate: SRSF1, SRSF3 and PTPN1 (PMID: 10480872; 19168442). It also regulates the alternative splicing of tissue factor (F3) pre-mRNA in endothelial cells (PMID: 19168442). Elevated CLK1 activity is frequently detected in cancers, where it alters splice isoform balance to promote proliferation, invasion and chemoresistance, making it an emerging therapeutic target.