CoraLite® Plus 488-conjugated CLN3 Monoclonal antibody

CLN3 Monoclonal Antibody for FC (Intra)
Cat No. CL488-67957
Clone No.1E10A9

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

FC (Intra)

1E10A9, Batten disease protein, BATTENIN, BTS, JNCL

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67957 targets CLN3 in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag31402

Product name: Recombinant human CLN3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 300-438 aa of BC002394

Sequence: QGLFELLFFWNTSLSHAQQYRWYQMLYQAGVFASRSSLRCCRIRFTWALALLQCLNLVFLLADVWFGFLPSIYLVFLIILYEGLLGGAAYVNTFHNIALETSDEHREFAMAATCISDTLGISLSGLLALPLHDFLCQLS

Predict reactive species
Full Name ceroid-lipofuscinosis, neuronal 3
Calculated Molecular Weight 438 aa, 48 kDa
Observed Molecular Weight50 kDa
GenBank Accession NumberBC002394
Gene Symbol CLN3
Gene ID (NCBI) 1201
RRIDAB_2934599
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ13286
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Neuronal ceroid lipofuscinosis (NCL, or Batten disease) refers to a group of lethal pediatric neurodegenerative diseases originating from mutations in one of the thus far identified 13 CLN genes (Ceroid Lipofuscinosis, Neuronal type; CLN1 to CLN14) (PMID: 25051496). CLN3 is a multi-membrane spanning protein that is involved in microtubule-dependent, anterograde transport of late endosomes and lysosomes. The CLN3 gene is located on chromosome 16p12.1and produces three mRNA splicing variants. The 438-amino-acid CLN3 protein has a calculated molecular weight of 48 kDa. It has been reported that CLN3 can be glycosylated and form homodimeric complex (PMID: 10356317; 17286803).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 CLN3 antibody CL488-67957Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...