CLN5 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85378-1-RR (same clone as 85378-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85378-1-RR (CLN5 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85378-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 85378-1-RR (same clone as 85378-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using CLN5 antibody (85378-1-RR, Clone: 242812H6 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 85378-1-PBS in a different storage buffer formulation.

CLN5 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 85378-1-PBS

Clone No.242812H6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

242812H6, Bis(monoacylglycero)phosphate synthase CLN5, Bis(monoacylglycero)phosphate synthase CLN5, secreted form, BMP synthase CLN5, BMPS

---

Product Information

85378-1-PBS targets CLN5 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag18175

  Product name: Recombinant human CLN5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 107-407 aa of BC153154

  Sequence: KRFDFRPKPDPYCQAKYTFCPTGSPIPVMEGDDDIEVFRLQAPVWEFKYGDLLGHLKIMHDAIGFRSTLTGKNYTMEWYELFQLGNCTFPHLRPEMDAPFWCNQGAACFFEGIDDVHWKENGTLVQVATISGNMFNQMAKWVKQDNETGIYYETWNVKASPEKGAETWFDSYDCSKFVLRTFNKLAEFGAEFKNIETNYTRIFLYSGEPTYLGNETSVFGPTGNKTLGLAIKRFYYPFKPHLPTKEFLLSLLQIFDAVIVHKQFYLFYNFEYWFLPMKFPFIKITYEEIPLPIRNKTLSGL

• Full Name: ceroid-lipofuscinosis, neuronal 5
• Calculated Molecular Weight: 407 aa, 46 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC153154
• Gene Symbol: CLN5
• Gene ID (NCBI): 1203
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O75503
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The CLN5 (ceroid lipofuscinosis neuronal protein 5) protein is ubiquitously expressed in the majority of tissues studied and in the brain, CLN5 shows both neuronal and glial cell expression. CLN5 plays a role in maintaining an acidic environment in the lysosomes, a critical feature for a functional lysosome (PMID: 38236309). Moreover, CLN5-deficient neuronal progenitor cells showed reduced thioesterase activity, confirming the live cell function of CLN5 in setting S-depalmitoylation levels (PMID: 35427157).