CLTB Monoclonal antibody, PBS Only

• 

  WB analysis of pig brain using 66270-1-Ig (same clone as 66270-1-PBS)

  pig brain tissue were subjected to SDS PAGE followed by western blot with 66270-1-Ig (CLTB antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66270-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 66270-1-Ig (same clone as 66270-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66270-1-Ig (CLTB Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 66270-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 66270-1-Ig (same clone as 66270-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66270-1-Ig (CLTB Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 66270-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 66270-1-Ig (same clone as 66270-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 66270-1-Ig (CLTB Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 66270-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 66270-1-Ig (same clone as 66270-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 66270-1-Ig (CLTB Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 66270-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 66270-1-Ig (same clone as 66270-1-PBS)

  Immunofluorescent analysis of (-20℃ Ethanol ) fixed HeLa cells using 66270-1-Ig(CLTB antibody) at dilution of 1:100 and Alexa Fluor 488-conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66270-1-PBS in a different storage buffer formulation.

CLTB Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66270-1-PBS

Clone No.1F9C2

Host / Isotype

Mouse / IgG1

Reactivity

human, pig

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Clathrin light chain B, clathrin, light chain (Lcb), CLTB, LCB

---

Product Information

66270-1-PBS targets CLTB in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, pig samples.

• Tested Reactivity: human, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24347

  Product name: Recombinant human CLTB protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-211 aa of BC006457

  Sequence: MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR

• Full Name: clathrin, light chain (Lcb)
• Calculated Molecular Weight: 23 kDa
• Observed Molecular Weight: 32-38 kDa
• GenBank Accession Number: BC006457
• Gene Symbol: CLTB
• Gene ID (NCBI): 1212
• RRID: AB_2881655
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P09497
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Clathrin is the major protein of the polyhedral coat of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. The clathrin molecule has a triskelion shape. Each clathrin triskelion is composed of three identical heavy chains (180 kDa) and three light chains of two types, LCA (CLTA) and LCB (CLTB) (30-40 kDa). The light chain subunits are thought to regulate the formation or disassembly of clathrin coats. (PMID: 2445759; 8374173; 3563513)