CNFN Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CNFN Polyclonal antibody, PBS Only (21425-1-PBS)

• 

  IP experiment of mouse skin using 21425-1-AP (same clone as 21425-1-PBS)

  IP result of anti-CNFN (IP:21425-1-AP, 4ug; Detection:21425-1-AP 1:500) with mouse skin tissue lysate 1120 ug. This data was developed using the same antibody clone with 21425-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HK-2 using 21425-1-AP (same clone as 21425-1-PBS)

  IP result of anti-CNFN (IP:21425-1-AP, 4ug; Detection:21425-1-AP 1:500) with HK-2 cells lysate 1000 ug. This data was developed using the same antibody clone with 21425-1-PBS in a different storage buffer formulation.

CNFN Polyclonal Antibody for IP, Indirect ELISA

Cat No. 21425-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IP, Indirect ELISA

Synonyms

cornifelin, PLAC8L2

---

Product Information

21425-1-PBS targets CNFN in IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16012

  Product name: Recombinant human CNFN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-112 aa of BC101197

  Sequence: MSYPVTSQPQCATTSCYQTQLSDWHTGLTDCCNDMPVCLCGTFAPLCLACRISDDFGECCCAPYLPGGLHSIRTGMRERYHIQGSVGHDWAALTFCLPCALCQMARELKIRE

• Full Name: cornifelin
• Calculated Molecular Weight: 112 aa, 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC101197
• Gene Symbol: CNFN
• Gene ID (NCBI): 84518
• RRID: AB_3742032
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BYD5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CNFN (cornifelin, also termed PLAC8L2) is highly expressed in the esophagus and skin, and is located on chromosome 19q13.2 (PMID: 30816522).