Product Information
31588-1-PBS targets CNTD2 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag36380 Product name: Recombinant human CNTD2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of NM_024877 Sequence: MLVRGRDQGSGSRLGPIVRRWAPRPSPLQSLAASLDAEPSSAAVPDGFPAGPTVSPRRLARPPGLEEALSALGLQGEREYAGDIFAEVMVCRVLPLRALP Predict reactive species |
| Full Name | cyclin N-terminal domain containing 2 |
| Calculated Molecular Weight | 33kDa |
| Observed Molecular Weight | 25 kDa |
| GenBank Accession Number | NM_024877 |
| Gene Symbol | CNTD2 |
| Gene ID (NCBI) | 79935 |
| RRID | AB_3670047 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q9H8S5 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
CNTD2, also known as Cyclin N-terminal domain containing 2 or CCNP, is a protein that has been implicated in cancer cell proliferation and migration, particularly in colon and lung cancers . It is an atypical cyclin that contains a cyclin box domain, which is a characteristic feature of cyclin-dependent kinase (CDK) binding partners. CNTD2 is considered an atypical cyclin due to its structural specificities, which were revealed through the human genome sequence project (PMID: 30087414). The apparent molecular mass measured by SDS-PAGE is 25 kDa.



