CNTD2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CNTD2 Polyclonal antibody, PBS Only (31588-1-PBS)

• 

  WB analysis using 31588-1-AP (same clone as 31588-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31588-1-AP (CNTD2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31588-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 31588-1-AP (same clone as 31588-1-PBS)

  WB result of CNTD2 antibody (31588-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CNTD2 transfected HepG2 cells. This data was developed using the same antibody clone with 31588-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CNTD2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31588-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Homo sapiens (Human), Cyclin-P , Cyclin P

---

Product Information

31588-1-PBS targets CNTD2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36380

  Product name: Recombinant human CNTD2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-100 aa of NM_024877

  Sequence: MLVRGRDQGSGSRLGPIVRRWAPRPSPLQSLAASLDAEPSSAAVPDGFPAGPTVSPRRLARPPGLEEALSALGLQGEREYAGDIFAEVMVCRVLPLRALP

• Full Name: cyclin N-terminal domain containing 2
• Calculated Molecular Weight: 33kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: NM_024877
• Gene Symbol: CNTD2
• Gene ID (NCBI): 79935
• RRID: AB_3670047
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9H8S5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CNTD2, also known as Cyclin N-terminal domain containing 2 or CCNP, is a protein that has been implicated in cancer cell proliferation and migration, particularly in colon and lung cancers . It is an atypical cyclin that contains a cyclin box domain, which is a characteristic feature of cyclin-dependent kinase (CDK) binding partners. CNTD2 is considered an atypical cyclin due to its structural specificities, which were revealed through the human genome sequence project (PMID: 30087414). The apparent molecular mass measured by SDS-PAGE is 25 kDa.