CoraLite® Plus 488-conjugated COIL Monoclonal antibody

• 

  FC experiment of HeLa using CL488-67218

  1X10^6 HeLa cells were intracellularly stained with 0.8 ug CoraLite® Plus 488 Anti-Human COIL (CL488-67218, Clone:2G12B8) (red), or 0.8 ug CoraLite® Plus 488 Mouse IgG1 Isotype Control (MOPC-21) (CL488-65124, Clone: MOPC-21) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

COIL Monoclonal Antibody for FC (Intra)

Cat No. CL488-67218

Clone No.2G12B8

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

FC (Intra)

Synonyms

Coilin, p80-coilin, p80 coilin, CLN80, 2G12B8

---

Tested Applications

• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67218 targets COIL in FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17171

  Product name: Recombinant human COIL protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 212-576 aa of BC010385

  Sequence: ANQRCSSPKGSARNSLVKAKRKGSVSVCSKESPSSSSESESCDESISDGPSKVTLEARNSSEKLPTELSKEEPSTKNTTADKLAIKLGFSLTPSKGKTSGTTSSSSDSSAESDDQCLMSSSTPECAAGFLKTVGLFAGRGRPGPGLSSQTAGAAGWRRSGSNGGGQAPGASPSVSLPASLGRGWGREENLFSWKGAKGRGMRGRGRGRGHPVSCVVNRSTDNQRQQQLNDVVKNSSTIIQNPVETPKKDYSLLPLLAAAPQVGEKIAFKLLELTSSYSPDVSDYKEGRILSHNPETQQVDIEILSSLPALREPGKFDLVYHNENGAEVVEYAVTQESKITVFWKELIDPRLIIESPSNTSSTEPA

• Full Name: coilin
• Calculated Molecular Weight: 576 aa, 63 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC010385
• Gene Symbol: COIL
• Gene ID (NCBI): 8161
• RRID: AB_3084327
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P38432
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.