Collagen Type X Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Collagen Type X Polyclonal antibody, PBS Only (26984-1-PBS)

• 

  WB analysis of ROS1728 using 26984-1-AP (same clone as 26984-1-PBS)

  ROS1728 cells were subjected to SDS PAGE followed by western blot with 26984-1-AP (COL10A1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26984-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 26984-1-AP (same clone as 26984-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26984-1-AP (COL10A1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26984-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 26984-1-AP (same clone as 26984-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using Collagen Type X antibody (26984-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 26984-1-PBS in a different storage buffer formulation.

Collagen Type X Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 26984-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

COL10, COL10A1, Col10a 1, Collagen alpha-1(X) chain, Collagen type X alpha 1

---

Product Information

26984-1-PBS targets Collagen Type X in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25741

  Product name: Recombinant human COL10A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 518-585 aa of BC130621

  Sequence: QAVMPEGFIKAGQRPSLSGTPLVSANQGVTGMPVSAFTVILSKAYPAIGTPIPFDKILYNRQQHYDPR

• Full Name: collagen, type X, alpha 1
• Calculated Molecular Weight: 680 aa, 66 kDa
• Observed Molecular Weight: 60-66 kDa
• GenBank Accession Number: BC130621
• Gene Symbol: COL10A1
• Gene ID (NCBI): 1300
• RRID: AB_3085918
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q03692
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Collagen type X alpha 1 (COL10A1), a secreted, short-chain collagen, belongs to the collagen family, which is a major interstitial matrix component specifically expressed by hypertrophic chondrocytes. COL10A1 expression is elevated in many solid tumor types, such as colon cancer, esophagus cancer, and breast cancer, and displays vital roles in many critical cellular processes (PMID: 30154451, 25321476).