COMMD5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• COMMD5 Polyclonal antibody, PBS Only (10393-1-PBS)

• 

  WB analysis of mouse kidney using 10393-1-AP (same clone as 10393-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 10393-1-AP (COMMD5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10393-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 10393-1-AP (same clone as 10393-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 10393-1-AP (COMMD5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10393-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human heart using 10393-1-AP (same clone as 10393-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 10393-1-AP (COMMD5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10393-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human stomach using 10393-1-AP (same clone as 10393-1-PBS)

  human stomach tissue were subjected to SDS PAGE followed by western blot with 10393-1-AP (COMMD5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10393-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse stomach using 10393-1-AP (same clone as 10393-1-PBS)

  mouse stomach tissue were subjected to SDS PAGE followed by western blot with 10393-1-AP (COMMD5 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10393-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse heart using 10393-1-AP (same clone as 10393-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 10393-1-AP (COMMD5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10393-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 10393-1-AP (same clone as 10393-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10393-1-AP (COMMD5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10393-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 10393-1-AP (same clone as 10393-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 10393-1-AP (COMMD5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10393-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse heart using 10393-1-AP (same clone as 10393-1-PBS)

  IP result of anti-COMMD5 (IP:10393-1-AP, 4ug; Detection:10393-1-AP 1:500) with mouse heart tissue lysate 3200ug. This data was developed using the same antibody clone with 10393-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 10393-1-AP (same clone as 10393-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using COMMD5 antibody (10393-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 10393-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

COMMD5 Polyclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 10393-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

COMM domain containing 5, COMM domain-containing protein 5, HCaRG, HT002, Hypertension-related calcium-regulated gene protein

---

Product Information

10393-1-PBS targets COMMD5 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0592

  Product name: Recombinant human COMMD5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 4-159 aa of BC003055

  Sequence: VGAATPYLHHPGDSHSGRVSFLGAQLPPEVAAMARLLGDLDRSTFRKLLKFVVSSLQGEDCREAVQRLGVSANLPEEQLGALLAGMHTLLQQALRLPPTSLKPDTFRDQLQELCIPQDLVGDLASVVFGSQRPLLDSVAQQQGAWLPHVADFRWRV

• Full Name: COMM domain containing 5
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC003055
• Gene Symbol: COMMD5
• Gene ID (NCBI): 28991
• RRID: AB_2083555
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9GZQ3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

COMM domain containing 5 (COMMD5, synonyms: HCARG, HT002) is a hypertension-related calcium-regulated gene. COMMD5 is negatively regulated by extracellular calcium concentration, and its basal mRNA levels were higher in hypertensive animals. Tissue distribution of COMMD5 shows a preponderance in the heart, stomach, jejunum, kidney (tubular fraction), liver, and adrenal gland (mainly in the medulla). COMMD5 mRNA is significantly more expressed in adult than in fetal organs, and its levels are decreased in tumors and cancerous cell lines. COMMD5 protein has no transmembrane domain, but contains 67% -helix content, a calcium-binding site, four putative "leucine zipper" motifs, and a nuclear receptor-binding domain. At the subcellular level, COMMD5 shows a nuclear localization.