COMMD8 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• COMMD8 Polyclonal antibody, PBS Only (25237-1-PBS)

• 

  WB analysis of HEK-293 using 25237-1-AP (same clone as 25237-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 25237-1-AP (COMMD8 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25237-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 25237-1-AP (same clone as 25237-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 25237-1-AP (COMMD8 antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25237-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 25237-1-AP (same clone as 25237-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using COMMD8 antibody (25237-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 25237-1-PBS in a different storage buffer formulation.

COMMD8 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 25237-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

COMM domain-containing protein 8, COMMD 8, MDS022

---

Product Information

25237-1-PBS targets COMMD8 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18712

  Product name: Recombinant human COMMD8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 9-182 aa of BC008371

  Sequence: LWRLQKLPAELGPQLLHKIIDGICGRAYPVYQDYHTVWESEEWMHVLEDIAKFFKAIVGKNLPDEEIFQQLNQLNSLHQETIMKCVKSRKDEIKQALSREIVAISSAQLQDFDWQVKLALSSDKIAALRMPLLSLHLDVKENGEVKPYSIEMSREELQNLIQSLEAANKVVLQL

• Full Name: COMM domain containing 8
• Calculated Molecular Weight: 183 aa, 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC008371
• Gene Symbol: COMMD8
• Gene ID (NCBI): 54951
• RRID: AB_2879980
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NX08
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.