COMP Monoclonal antibody

COMP Monoclonal Antibody for WB, IF/ICC, ELISA
Cat No. 66793-1-Ig
Clone No.1D7A6

Host / Isotype

Mouse / IgG1

Reactivity

human, pig

Applications

WB, IF/ICC, ELISA

TSP5, 1D7A6, Cartilage oligomeric matrix protein, PSACH, Thrombospondin-5

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inpig cartilage tissue
Positive IF/ICC detected inHepG2 cells, U2OS cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66793-1-Ig targets COMP in WB, IF/ICC, ELISA applications and shows reactivity with human, pig samples.

Tested Reactivity human, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag4575

Product name: Recombinant human COMP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 407-757 aa of BC033676

Sequence: DNCPQKSNPDQADVDHDFVGDACDSDQDQDGDGHQDSRDNCPTVPNSAQEDSDHDGQGDACDDDDDNDGVPDSRDNCRLVPNPGQEDADRDGVGDVCQDDFDADKVVDKIDVCPENAEVTLTDFRAFQTVVLDPEGDAQIDPNWVVLNQGREIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFIFGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDTESQVRLLWKDPRNVGWKDKKSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTMRGGRLGVFCFSQENIIWANLRYRCNDTIPEDYETHQLRQA

Predict reactive species
Full Name cartilage oligomeric matrix protein
Calculated Molecular Weight 757 aa, 83 kDa
Observed Molecular Weight 100-130 kDa
GenBank Accession NumberBC033676
Gene Symbol COMP
Gene ID (NCBI) 1311
RRIDAB_2882137
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP49747
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

COMP is a secreted pentameric glycoprotein built from modular units and belongs to the thrombospondin protein family. COMP is expressed by hypertrophic chondrocytes and osteoblasts during endochondral ossification, and its expression is increased during fracture healing. COMP is involved in the assembly of collagen fibrils and other structural matrix components. COMP interacts with a number of cartilage ECM proteins, including fibronectin, collagen I, II IX, XII, and XIV, matrilins, as well as proteoglycans such as aggrecan and others. This antibody got 100-130 kDa maybe due to glycosylation.

Protocols

Product Specific Protocols
IF protocol for COMP antibody 66793-1-IgDownload protocol
WB protocol for COMP antibody 66793-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...